Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G46460 134 / 6e-38 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G08820 107 / 1e-28 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G37170 105 / 8e-28 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G27610 102 / 8e-27 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G49142 100 / 8e-26 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G30700 96 / 2e-24 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G61170 94 / 1e-23 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G12770 92 / 6e-23 MEF22 mitochondrial editing factor 22 (.1) AT5G39680 91 / 2e-22 EMB2744 EMBRYO DEFECTIVE 2744, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G57430 91 / 2e-22 OTP84 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G354400 [exp] 182 / 2e-55 AT5G46460 863 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.006G105700 [exp] 103 / 7e-27 AT3G08820 810 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.017G091600 [exp] 102 / 8e-27 AT4G37170 924 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G155100 [exp] 102 / 9e-27 AT3G61170 933 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.016G128900 [exp] 99 / 2e-25 AT3G08820 812 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.015G018700 [exp] 98 / 4e-25 AT3G49170 1040 / 0.0 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G044700 [exp] 98 / 5e-25 AT3G22690 582 / 0.0 unknown protein Potri.001G075800 [exp] 96 / 3e-24 AT3G57430 1189 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G322100 [exp] 95 / 6e-24 AT3G26782 897 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015256 [exp] 129 / 5e-36 AT5G46460 840 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10022890 [exp] 104 / 3e-27 AT3G61170 865 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10024936 [exp] 102 / 1e-26 AT3G61170 855 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10029436 [exp] 96 / 2e-24 AT3G08820 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10018897 [exp] 96 / 3e-24 AT5G16860 970 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10020588 [exp] 93 / 4e-24 AT2G27610 422 / 2e-142 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10028593 [exp] 95 / 7e-24 AT5G16860 879 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10004892 [exp] 94 / 1e-23 AT2G27610 998 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10010850 [exp] 94 / 1e-23 AT5G60020 856 / 0.0 laccase 17 (.1) Lus10019689 [exp] 88 / 2e-23 AT2G22070 246 / 4e-78 pentatricopeptide (PPR) repeat-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0109 [poplar] [flax] CDA PF14432 [poplar] [flax] DYW_deaminase DYW family of nucleic acid deaminases
Representative CDS sequence Show only first row Show all	>Potri.001G267100.2 pacid=42789654 polypeptide=Potri.001G267100.2.p locus=Potri.001G267100 ID=Potri.001G267100.2.v4.1 annot-version=v4.1 ATGAGAGTGAAGATGAAACAAGGACTTGCGAAACAACCAGGATCTAGTTGGGTAGTTTTGAGGGGAAAGAAACATGAGTTTCTTTCTGCAGACAGATCAC ATCCTCTAAGTGAGAGAATATATGAAAAGCTGGACTGGTTGAGAAAAAAGTTGAAGGAATTTGGTTATGTTCCTGATCAAAAATTTGCTCTACATGATGT CGAGGATGAGCAGAAGGAAGTGATGTTGTCTTTTCACAGTGAGAGGCTTGCTATTGCGTTTGGGCTAGTTAGCACCGTGCACAATAACAGTCATGAAGAA TCTTCGTGTATCTGA
AA sequence Show only first row Show all	>Potri.001G267100.2 pacid=42789654 polypeptide=Potri.001G267100.2.p locus=Potri.001G267100 ID=Potri.001G267100.2.v4.1 annot-version=v4.1 MRVKMKQGLAKQPGSSWVVLRGKKHEFLSADRSHPLSERIYEKLDWLRKKLKEFGYVPDQKFALHDVEDEQKEVMLSFHSERLAIAFGLVSTVHNNSHEE SSCI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G46460			Pentatricopeptide repeat (PPR)...		Potri.001G267100 [exp]	0	1
AT5G53540			P-loop containing nucleoside t...		Potri.012G013580 [exp]	2.44	0.8381
AT5G44950			F-box/RNI-like/FBD-like domain...		Potri.012G099400 [exp]	2.82	0.8199
AT1G04520		PDLP2	plasmodesmata-located protein ...		Potri.002G257300 [exp]	3.46	0.8347
AT1G76900	TUB	AtTLP1	tubby like protein 1 (.1.2)		Potri.002G068200 [exp]	4.24	0.8004
AT5G53540			P-loop containing nucleoside t...		Potri.012G015670 [exp]	5.19	0.8294
					Potri.010G186750 [exp]	5.91	0.8067
AT5G51030			NAD(P)-binding Rossmann-fold s...		Potri.012G110200 [exp]	6.00	0.7398
AT4G14103			F-box/RNI-like superfamily pro...		Potri.001G395000 [exp]	8.36	0.7987
AT1G25420			Regulator of Vps4 activity in ...		Potri.010G124100 [exp]	9.00	0.7947
					Potri.013G094050 [exp]	9.21	0.7765

Compare expression of checked genes

Potri.001G267100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.