Potri.001G268500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G063200 44 / 1e-07 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019700 35 / 0.0007 ND /
PFAM info
Representative CDS sequence
>Potri.001G268500.1 pacid=42789824 polypeptide=Potri.001G268500.1.p locus=Potri.001G268500 ID=Potri.001G268500.1.v4.1 annot-version=v4.1
ATGGAATTTGCCACAATGAAGTTTCTCGCTGCTGTTCTTGTAATGGCGATGTTTGCTAGCGTTCATGTTTCTGCTCAAGATTTTGGAGAGATGGCACCAG
CGCCAGCACCAGCAATTGGCGCGGGCGCTGCTTCTTATTCTTTTGGGACTTCCGGGGCTCTTATCTGCTCTTCTCTCTTCTTGTCCATGCTCGCTCTTTT
GAGGCATTAG
AA sequence
>Potri.001G268500.1 pacid=42789824 polypeptide=Potri.001G268500.1.p locus=Potri.001G268500 ID=Potri.001G268500.1.v4.1 annot-version=v4.1
MEFATMKFLAAVLVMAMFASVHVSAQDFGEMAPAPAPAIGAGAASYSFGTSGALICSSLFLSMLALLRH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G268500 0 1
AT5G64300 ATGCH, ATRIBA1,... RED FLUORESCENT IN DARKNESS 1,... Potri.017G050400 14.31 0.9353
AT3G19615 unknown protein Potri.001G294800 18.54 0.9176
AT4G37370 CYP81D8 "cytochrome P450, family 81, s... Potri.002G121300 22.75 0.9285
AT2G26560 PLP2, PLAIIA, P... PATATIN-LIKE PROTEIN 2, phosph... Potri.017G133850 25.37 0.9118
AT3G04120 GAPC1, GAPC-1, ... glyceraldehyde-3-phosphate deh... Potri.008G179300 27.76 0.9233 GAPDH.1
AT3G54420 ATCHITIV, CHIV,... CHITINASE CLASS IV, homolog of... Potri.019G093800 40.76 0.9119
Potri.001G268400 56.07 0.9018
AT2G26560 PLP2, PLAIIA, P... PATATIN-LIKE PROTEIN 2, phosph... Potri.017G134001 62.68 0.9013
AT2G26560 PLP2, PLAIIA, P... PATATIN-LIKE PROTEIN 2, phosph... Potri.017G134051 79.44 0.8950
AT2G03550 alpha/beta-Hydrolases superfam... Potri.009G104000 79.54 0.8741

Potri.001G268500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.