Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G19740 162 / 4e-53 Ribosomal protein L31e family protein (.1) AT5G56710 161 / 1e-52 Ribosomal protein L31e family protein (.1.2) AT4G26230 159 / 1e-51 Ribosomal protein L31e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G064100 [exp] 194 / 1e-65 AT2G19740 164 / 1e-53 Ribosomal protein L31e family protein (.1) Potri.018G070100 [exp] 169 / 2e-55 AT2G19740 170 / 6e-56 Ribosomal protein L31e family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037703 [exp] 172 / 1e-56 AT5G56710 199 / 1e-67 Ribosomal protein L31e family protein (.1.2) Lus10015698 [exp] 170 / 6e-56 AT5G56710 201 / 2e-68 Ribosomal protein L31e family protein (.1.2) Lus10025830 [exp] 159 / 1e-51 AT2G19740 200 / 5e-68 Ribosomal protein L31e family protein (.1) Lus10042028 [exp] 158 / 2e-51 AT2G19740 198 / 3e-67 Ribosomal protein L31e family protein (.1) Lus10018032 [exp] 152 / 1e-48 AT2G19740 191 / 3e-64 Ribosomal protein L31e family protein (.1) Lus10038272 [exp] 160 / 7e-48 AT2G19740 200 / 9e-63 Ribosomal protein L31e family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01198 [poplar] [flax] Ribosomal_L31e Ribosomal protein L31e
Representative CDS sequence Show only first row Show all	>Potri.001G269600.1 pacid=42787542 polypeptide=Potri.001G269600.1.p locus=Potri.001G269600 ID=Potri.001G269600.1.v4.1 annot-version=v4.1 ATGCCGGAGAAATCAGGGAAAGGAAGAAAGGAAGAGGTTATCACCAGAGAATACACCATCAACCTTCACAAACGCTTGCATGGATGCACCTTCAAGAAGA AGGCTCCAAAGGCCATCAAGGAGATAAGGAAGTTTGCACAGAAGGCCATGAAGACAACTGATGTCAGAGTTGATGTTAAGCTAAACAAGCATGTGTGGAG CCGAGGTATTAGGAGTGTGCCAAGGAGAGTTCGTGTTCGTGTTGCACGGAAGAGGAATGATGAAGAAGATGCCAAGGAAGAATTTTATTCCCTTGTCACT GTTTCAGAGCTTCCTCCAGAGGGATTTAAGGGTTTGGGCACCAAGGTCATTGATGACGAAGAAGAATGA
AA sequence Show only first row Show all	>Potri.001G269600.1 pacid=42787542 polypeptide=Potri.001G269600.1.p locus=Potri.001G269600 ID=Potri.001G269600.1.v4.1 annot-version=v4.1 MPEKSGKGRKEEVITREYTINLHKRLHGCTFKKKAPKAIKEIRKFAQKAMKTTDVRVDVKLNKHVWSRGIRSVPRRVRVRVARKRNDEEDAKEEFYSLVT VSELPPEGFKGLGTKVIDDEEE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G19740			Ribosomal protein L31e family ...		Potri.001G269600 [exp]	0	1
AT5G59850			Ribosomal protein S8 family pr...		Potri.003G114800 [exp]	1.41	0.9770	RPS15.1
AT2G19730			Ribosomal L28e protein family ...		Potri.001G194000 [exp]	2.82	0.9652
AT5G57290			60S acidic ribosomal protein f...		Potri.003G010200 [exp]	2.82	0.9499
AT5G57290			60S acidic ribosomal protein f...		Potri.009G032600 [exp]	3.46	0.9580
AT4G25740			RNA binding Plectin/S10 domain...		Potri.005G040100 [exp]	4.58	0.9579
AT2G27710			60S acidic ribosomal protein f...		Potri.004G185800 [exp]	4.69	0.9677
AT5G02960			Ribosomal protein S12/S23 fami...		Potri.006G131500 [exp]	5.74	0.9662
AT4G33865			Ribosomal protein S14p/S29e fa...		Potri.002G119600 [exp]	6.00	0.9459
AT2G19730			Ribosomal L28e protein family ...		Potri.003G045500 [exp]	7.41	0.9622
AT5G59850			Ribosomal protein S8 family pr...		Potri.001G118100 [exp]	9.38	0.9465	Pt-WRP15.2

Compare expression of checked genes

Potri.001G269600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.