Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G12190 227 / 1e-78 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT2G14870 113 / 1e-33 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G08695 56 / 4e-10 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT4G02430 51 / 1e-08 SR34b, At-SR34b Serine/Arginine-Rich Protein Splicing Factor 34b, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT2G30260 50 / 3e-08 U2B'' U2 small nuclear ribonucleoprotein B (.1) AT1G02840 50 / 3e-08 ATSRP34, SR1, SR34, At-SR34 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) AT2G35410 50 / 4e-08 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G06960 48 / 2e-07 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) AT1G60000 48 / 2e-07 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT4G19610 47 / 5e-07 nucleotide binding;nucleic acid binding;RNA binding (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G067500 [exp] 247 / 3e-86 AT5G12190 226 / 4e-78 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.005G024600 [exp] 54 / 2e-09 AT1G09140 258 / 6e-86 Serine/Arginine-Rich Protein Splicing Factor 30, SERINE-ARGININE PROTEIN 30 (.1.2) Potri.006G190900 [exp] 52 / 9e-09 AT3G15010 179 / 6e-53 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.019G121400 [exp] 49 / 9e-08 AT2G30260 305 / 7e-106 U2 small nuclear ribonucleoprotein B (.1) Potri.002G214000 [exp] 49 / 1e-07 AT4G03110 506 / 4e-179 RNA-binding protein-defense related 1 (.1.2) Potri.016G048100 [exp] 49 / 2e-07 AT3G15010 181 / 1e-53 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.014G129900 [exp] 47 / 4e-07 AT1G02840 272 / 5e-91 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Potri.002G205025 [exp] 47 / 4e-07 AT1G02840 272 / 1e-90 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Potri.013G153700 [exp] 47 / 5e-07 AT2G30260 297 / 8e-103 U2 small nuclear ribonucleoprotein B (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026814 [exp] 234 / 3e-81 AT5G12190 225 / 8e-78 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10026815 [exp] 200 / 9e-68 AT5G12190 192 / 9e-65 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10027733 [exp] 52 / 2e-08 AT2G36660 569 / 0.0 poly(A) binding protein 7 (.1) Lus10007869 [exp] 49 / 1e-07 AT1G02840 308 / 1e-105 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Lus10016174 [exp] 49 / 1e-07 AT3G52380 275 / 3e-91 PIGMENT DEFECTIVE 322, chloroplast RNA-binding protein 33 (.1) Lus10008218 [exp] 48 / 3e-07 AT1G02840 228 / 3e-73 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Lus10029885 [exp] 48 / 3e-07 AT1G02840 253 / 2e-81 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Lus10003606 [exp] 47 / 4e-07 AT1G02840 299 / 5e-102 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Lus10020656 [exp] 47 / 5e-07 AT1G02840 297 / 2e-100 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Lus10026413 [exp] 45 / 2e-06 AT2G30260 350 / 1e-123 U2 small nuclear ribonucleoprotein B (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.001G273200.1 pacid=42791223 polypeptide=Potri.001G273200.1.p locus=Potri.001G273200 ID=Potri.001G273200.1.v4.1 annot-version=v4.1 ATGGCGCAAACAATCAGCCTCCGCAAAGGCAACACCCGTCTTCCACCTGAGGTGAACCGCGTCCTCTACGTCCGTAATCTTCCATTCAACATATCCAGCG AAGAGATGTACGATATATTTGGCAAATACGGAGCGATTCGTCAAATCCGGATCGGAACCAACAAGGACACTAGAGGCACTGCTTTTGTGGTTTATGAAGA TATATACGATGCCAAAACGGCAGTGGATCACTTGTCAGGGTTCAATGTGGCGAATCGGTATTTGATTGTGCTGTATTATCAGCCAGCGAAGATGAATAAG AAGTTTGATCAGAAGAAGAAAGAAGAAGAGATTGCTAAGATGCAGGAGAAATATGGTGTTTCTACTAAAGATAAGTAG
AA sequence Show only first row Show all	>Potri.001G273200.1 pacid=42791223 polypeptide=Potri.001G273200.1.p locus=Potri.001G273200 ID=Potri.001G273200.1.v4.1 annot-version=v4.1 MAQTISLRKGNTRLPPEVNRVLYVRNLPFNISSEEMYDIFGKYGAIRQIRIGTNKDTRGTAFVVYEDIYDAKTAVDHLSGFNVANRYLIVLYYQPAKMNK KFDQKKKEEEIAKMQEKYGVSTKDK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G12190			RNA-binding (RRM/RBD/RNP motif...		Potri.001G273200 [exp]	0	1
AT2G37410		ATTIM17-2	TRANSLOCASE OF THE INNER MEMBR...		Potri.018G087900 [exp]	6.16	0.6497
AT1G52740		HTA9	histone H2A protein 9 (.1)		Potri.018G032000 [exp]	7.34	0.6680
AT4G35490		MRPL11	mitochondrial ribosomal protei...		Potri.007G058600 [exp]	7.93	0.7430
AT5G56940			Ribosomal protein S16 family p...		Potri.004G217400 [exp]	11.87	0.7071	Pt-RPS16.2
AT3G06700			Ribosomal L29e protein family ...		Potri.008G107700 [exp]	13.63	0.7215
AT4G15780		ATVAMP724	vesicle-associated membrane pr...		Potri.008G209100 [exp]	19.07	0.6289
AT1G19360		RRA3	reduced residual arabinose 3, ...		Potri.014G042700 [exp]	23.55	0.6166
AT5G35530			Ribosomal protein S3 family pr...		Potri.012G076800 [exp]	24.00	0.6932
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Potri.001G069100 [exp]	26.58	0.6806	Pt-ARS27.2
AT3G13230			RNA-binding KH domain-containi...		Potri.011G166000 [exp]	30.49	0.6674

Compare expression of checked genes

Potri.001G273200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.