Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G12320 191 / 1e-63 ankyrin repeat family protein (.1) AT4G35450 74 / 4e-16 AKR2A, AFT, AKR2 ankyrin repeat-containing protein 2 (.1.2.3.4.5) AT2G17390 67 / 2e-13 AKR2B ankyrin repeat-containing 2B (.1) AT4G19150 64 / 7e-13 Ankyrin repeat family protein (.1.2) AT5G20350 63 / 3e-12 TIP1 TIP GROWTH DEFECTIVE 1, Ankyrin repeat family protein with DHHC zinc finger domain (.1) AT4G27780 61 / 2e-11 ACBP2 acyl-CoA binding protein 2 (.1) AT5G57740 60 / 3e-11 XBAT32 XB3 ortholog 2 in Arabidopsis thaliana (.1) AT5G53470 60 / 3e-11 ACBP1 acyl-CoA binding protein 1 (.1) AT2G03430 59 / 4e-11 Ankyrin repeat family protein (.1) AT5G02620 56 / 7e-10 ATANK1, ANK1 ankyrin-like1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G070700 [exp] 239 / 2e-82 AT5G12320 197 / 6e-66 ankyrin repeat family protein (.1) Potri.010G185200 [exp] 71 / 7e-15 AT2G03430 76 / 3e-15 Ankyrin repeat family protein (.1) Potri.013G062000 [exp] 66 / 5e-13 AT2G03430 94 / 2e-21 Ankyrin repeat family protein (.1) Potri.004G210100 [exp] 65 / 8e-13 AT2G17390 430 / 3e-151 ankyrin repeat-containing 2B (.1) Potri.004G210000 [exp] 65 / 8e-13 AT2G17390 418 / 1e-146 ankyrin repeat-containing 2B (.1) Potri.018G121200 [exp] 63 / 4e-12 AT5G20350 951 / 0.0 TIP GROWTH DEFECTIVE 1, Ankyrin repeat family protein with DHHC zinc finger domain (.1) Potri.012G017700 [exp] 62 / 5e-12 AT4G27780 432 / 4e-152 acyl-CoA binding protein 2 (.1) Potri.006G061800 [exp] 61 / 2e-11 AT5G20350 959 / 0.0 TIP GROWTH DEFECTIVE 1, Ankyrin repeat family protein with DHHC zinc finger domain (.1) Potri.003G103400 [exp] 60 / 2e-11 AT4G19150 234 / 2e-77 Ankyrin repeat family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036033 [exp] 224 / 2e-76 AT5G12320 186 / 2e-61 ankyrin repeat family protein (.1) Lus10009696 [exp] 223 / 1e-75 AT5G12320 184 / 7e-61 ankyrin repeat family protein (.1) Lus10001605 [exp] 65 / 1e-12 AT4G38130 833 / 0.0 ARABIDOPSIS HISTONE DEACETYLASE 19, ARABIDOPSIS HISTONE DEACETYLASE 1, histone deacetylase 1 (.1.2) Lus10001414 [exp] 64 / 1e-12 AT4G19150 245 / 9e-82 Ankyrin repeat family protein (.1.2) Lus10013859 [exp] 63 / 4e-12 AT2G17390 427 / 1e-150 ankyrin repeat-containing 2B (.1) Lus10020272 [exp] 62 / 8e-12 AT5G13530 97 / 9e-21 KEEP ON GOING, protein kinases;ubiquitin-protein ligases (.1.2) Lus10008037 [exp] 61 / 2e-11 AT5G20350 905 / 0.0 TIP GROWTH DEFECTIVE 1, Ankyrin repeat family protein with DHHC zinc finger domain (.1) Lus10022382 [exp] 60 / 4e-11 AT4G27780 432 / 2e-152 acyl-CoA binding protein 2 (.1) Lus10002621 [exp] 60 / 4e-11 AT5G13530 99 / 6e-22 KEEP ON GOING, protein kinases;ubiquitin-protein ligases (.1.2) Lus10026575 [exp] 60 / 6e-11 AT2G17390 427 / 2e-150 ankyrin repeat-containing 2B (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0465 [poplar] [flax] Ank PF13637 [poplar] [flax] Ank_4 Ankyrin repeats (many copies)
Representative CDS sequence Show only first row Show all	>Potri.001G276100.1 pacid=42791818 polypeptide=Potri.001G276100.1.p locus=Potri.001G276100 ID=Potri.001G276100.1.v4.1 annot-version=v4.1 ATGGGAGAGGGAGCAAACCAGGCAGAGCAGCAAACCCAAATAGAAACAACACCGGAGACTGTTGATGCTTTACTTGAGGCTGCTAGATATGATGATATTG AGGATATTGCAAGGTTAGAATCTTCTGGGGTTTCTCTTGATTCTAAAGATTCGCTGGGCAGAACAGCACTCCATATGGCTGCAGCCAATGGACATCTTGA CATTGTGGAGTATCTTATCAGTCAGGGAGTGGATCTCAATGCTGCCAATAAGGAGAAGAATACAGCTCTTCACTGGGCTTGCCTCAATGGTCATATTGAG GTGGTTAAGAAATTGATTCTGGCAGGATCGAGTTTAGGCTTTCTAAACAGCCATGAACGGACCCCAATGGATGAAGCTGTTACTCGGGAAAAAATGGATG TTATTGATGCAATTAACGCAGCTGTGGCACAACTGGAACTTGCTGGTGTTGCAGTTTCCTAG
AA sequence Show only first row Show all	>Potri.001G276100.1 pacid=42791818 polypeptide=Potri.001G276100.1.p locus=Potri.001G276100 ID=Potri.001G276100.1.v4.1 annot-version=v4.1 MGEGANQAEQQTQIETTPETVDALLEAARYDDIEDIARLESSGVSLDSKDSLGRTALHMAAANGHLDIVEYLISQGVDLNAANKEKNTALHWACLNGHIE VVKKLILAGSSLGFLNSHERTPMDEAVTREKMDVIDAINAAVAQLELAGVAVS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G12320			ankyrin repeat family protein ...		Potri.001G276100 [exp]	0	1
AT5G02960			Ribosomal protein S12/S23 fami...		Potri.010G217100 [exp]	1.41	0.8859	RPS23.2
AT1G55880			Pyridoxal-5'-phosphate-depende...		Potri.001G367000 [exp]	3.46	0.7683
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Potri.001G069100 [exp]	3.87	0.8398	Pt-ARS27.2
AT1G13380			Protein of unknown function (D...		Potri.010G124800 [exp]	4.00	0.8310
AT1G26880			Ribosomal protein L34e superfa...		Potri.012G108400 [exp]	8.36	0.8446	RPL34.4
AT5G52370			unknown protein		Potri.001G246800 [exp]	9.53	0.8055
AT5G65260			RNA-binding (RRM/RBD/RNP motif...		Potri.001G311600 [exp]	11.53	0.7530
AT4G11260		RPR1, ETA3, EDM...	ENHANCER OF TIR1-1 AUXIN RESIS...		Potri.017G149800 [exp]	12.48	0.6771
AT4G23760			Cox19-like CHCH family protein...		Potri.003G136500 [exp]	14.00	0.6998
AT4G13720			Inosine triphosphate pyrophosp...		Potri.001G052400 [exp]	14.69	0.7533

Compare expression of checked genes

Potri.001G276100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.