Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G56630 209 / 4e-64 CYP94D2 "cytochrome P450, family 94, subfamily D, polypeptide 2", cytochrome P450, family 94, subfamily D, polypeptide 2 (.1) AT1G34540 201 / 5e-61 CYP94D1 "cytochrome P450, family 94, subfamily D, polypeptide 1", cytochrome P450, family 94, subfamily D, polypeptide 1 (.1) AT3G48520 193 / 5e-58 CYP94B3 cytochrome P450, family 94, subfamily B, polypeptide 3 (.1) AT5G63450 189 / 2e-56 CYP94B1 "cytochrome P450, family 94, subfamily B, polypeptide 1", cytochrome P450, family 94, subfamily B, polypeptide 1 (.1) AT3G01900 175 / 4e-51 CYP94B2 "cytochrome P450, family 94, subfamily B, polypeptide 2", cytochrome P450, family 94, subfamily B, polypeptide 2 (.1) AT2G27690 169 / 7e-49 CYP94C1 "cytochrome P450, family 94, subfamily C, polypeptide 1", cytochrome P450, family 94, subfamily C, polypeptide 1 (.1) AT1G69500 165 / 3e-47 CYP704B1 "cytochrome P450, family 704, subfamily B, polypeptide 1", cytochrome P450, family 704, subfamily B, polypeptide 1 (.1) AT5G08250 162 / 1e-46 Cytochrome P450 superfamily protein (.1) AT1G63710 157 / 2e-44 CYP86A7 "cytochrome P450, family 86, subfamily A, polypeptide 7", cytochrome P450, family 86, subfamily A, polypeptide 7 (.1) AT5G23190 157 / 3e-44 CYP86B1 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G031800 [exp] 238 / 5e-77 AT3G56630 402 / 1e-138 "cytochrome P450, family 94, subfamily D, polypeptide 2", cytochrome P450, family 94, subfamily D, polypeptide 2 (.1) Potri.016G031700 [exp] 234 / 6e-74 AT3G56630 629 / 0.0 "cytochrome P450, family 94, subfamily D, polypeptide 2", cytochrome P450, family 94, subfamily D, polypeptide 2 (.1) Potri.005G220700 [exp] 221 / 5e-69 AT3G48520 436 / 4e-149 cytochrome P450, family 94, subfamily B, polypeptide 3 (.1) Potri.006G033600 [exp] 219 / 4e-68 AT3G56630 576 / 0.0 "cytochrome P450, family 94, subfamily D, polypeptide 2", cytochrome P450, family 94, subfamily D, polypeptide 2 (.1) Potri.005G220900 [exp] 216 / 8e-67 AT3G48520 414 / 2e-140 cytochrome P450, family 94, subfamily B, polypeptide 3 (.1) Potri.002G042200 [exp] 215 / 1e-66 AT5G63450 442 / 3e-151 "cytochrome P450, family 94, subfamily B, polypeptide 1", cytochrome P450, family 94, subfamily B, polypeptide 1 (.1) Potri.002G042100 [exp] 213 / 1e-65 AT3G48520 451 / 1e-154 cytochrome P450, family 94, subfamily B, polypeptide 3 (.1) Potri.012G096800 [exp] 207 / 3e-63 AT3G48520 611 / 0.0 cytochrome P450, family 94, subfamily B, polypeptide 3 (.1) Potri.001G331100 [exp] 183 / 3e-54 AT3G01900 597 / 0.0 "cytochrome P450, family 94, subfamily B, polypeptide 2", cytochrome P450, family 94, subfamily B, polypeptide 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036024 [exp] 276 / 1e-89 AT3G56630 380 / 3e-127 "cytochrome P450, family 94, subfamily D, polypeptide 2", cytochrome P450, family 94, subfamily D, polypeptide 2 (.1) Lus10014741 [exp] 212 / 4e-65 AT5G63450 461 / 1e-158 "cytochrome P450, family 94, subfamily B, polypeptide 1", cytochrome P450, family 94, subfamily B, polypeptide 1 (.1) Lus10014742 [exp] 211 / 8e-65 AT5G63450 451 / 8e-155 "cytochrome P450, family 94, subfamily B, polypeptide 1", cytochrome P450, family 94, subfamily B, polypeptide 1 (.1) Lus10033853 [exp] 196 / 2e-59 AT5G63450 474 / 7e-164 "cytochrome P450, family 94, subfamily B, polypeptide 1", cytochrome P450, family 94, subfamily B, polypeptide 1 (.1) Lus10033852 [exp] 196 / 7e-59 AT5G63450 457 / 4e-157 "cytochrome P450, family 94, subfamily B, polypeptide 1", cytochrome P450, family 94, subfamily B, polypeptide 1 (.1) Lus10041562 [exp] 173 / 3e-50 AT3G01900 597 / 0.0 "cytochrome P450, family 94, subfamily B, polypeptide 2", cytochrome P450, family 94, subfamily B, polypeptide 2 (.1) Lus10012531 [exp] 172 / 8e-50 AT3G01900 592 / 0.0 "cytochrome P450, family 94, subfamily B, polypeptide 2", cytochrome P450, family 94, subfamily B, polypeptide 2 (.1) Lus10018217 [exp] 165 / 2e-47 AT5G58860 802 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 1", cytochrome P450, family 86, subfamily A, polypeptide 1 (.1) Lus10037157 [exp] 165 / 4e-47 AT1G69500 868 / 0.0 "cytochrome P450, family 704, subfamily B, polypeptide 1", cytochrome P450, family 704, subfamily B, polypeptide 1 (.1) Lus10040687 [exp] 164 / 7e-47 AT5G58860 803 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 1", cytochrome P450, family 86, subfamily A, polypeptide 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [poplar] [flax] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Potri.001G277301.1 pacid=42792457 polypeptide=Potri.001G277301.1.p locus=Potri.001G277301 ID=Potri.001G277301.1.v4.1 annot-version=v4.1 ATGTTGGAACTCTCCTTTCTTATCTTGTTTCTCACTTCCATTTCAGTCCTCATCTTCATTTGCTTCTTCCGCTCCACTTCTCACCCTCCAAGCAAAACCC CATGTCCAGAATCTTACCCTATAATAGGAATCCTCCCCGGCCTCCTCCGCAACCGCCACCGCTTCCACGACTGGGTCGCTGACATGCTCTCCAAAACCCC ATCATCGACTCTCCAAGTCAACAACTTTCTCAACCTCTCCCATATCATCTGCACTGCCAACCCTGTCAATGTAGAGCACCTCCTTGTCACCAACTTCTCT AACTATATCAAAGGTTGTCGTTATCTTGACTATCTCCAAGAACTCCTTGGCCATGGAATCTTTAACGTTGATGGTCACCTCTGGACTGTACAACGTAAGA TTGCTAGCCATGAATTCAACACTAAATCTCTCAAACACTTCGTATCAGATATAGTCAAATCTGAACTGTCCAAAAGTCTCATGCCAGACTTATTCAAAGC ATGTGATCACAACTTGATCATCGATATGCAAGAGGTGTTGCAAAAGTTCACTTTCACTAACTTATGCAAAGTTGCTTTTGGGGTTGACCCTGAATCCATG TCAAATTTAACTTTTGTTGAGGCTTTTGATGATGCTGTGGAAATTGGGTTTTCAAGATTTATGGCTCCACTTCCTGCGTTATGGAAGCTTCAAAGATCCT TGAATATAGGATCAGAGAAGAGACTTAAAGAAGCTGTTAAAGTGATTAATGAGTTTGCTTGGGAGGTAATAAAATCGAGACAAGAACAAGATGGCGGCAA GAATCAAGATTGCTGTCAAGATTTATGTTGTTGA
AA sequence Show only first row Show all	>Potri.001G277301.1 pacid=42792457 polypeptide=Potri.001G277301.1.p locus=Potri.001G277301 ID=Potri.001G277301.1.v4.1 annot-version=v4.1 MLELSFLILFLTSISVLIFICFFRSTSHPPSKTPCPESYPIIGILPGLLRNRHRFHDWVADMLSKTPSSTLQVNNFLNLSHIICTANPVNVEHLLVTNFS NYIKGCRYLDYLQELLGHGIFNVDGHLWTVQRKIASHEFNTKSLKHFVSDIVKSELSKSLMPDLFKACDHNLIIDMQEVLQKFTFTNLCKVAFGVDPESM SNLTFVEAFDDAVEIGFSRFMAPLPALWKLQRSLNIGSEKRLKEAVKVINEFAWEVIKSRQEQDGGKNQDCCQDLCC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G56630		CYP94D2	"cytochrome P450, family 94, s...		Potri.001G277301 [exp]	0	1
AT1G54470		RPP27	resistance to Peronospora para...		Potri.018G145520 [exp]	6.48	0.7111
AT1G13480			Protein of unknown function (D...		Potri.008G109400 [exp]	17.05	0.8220
AT4G27360			Dynein light chain type 1 fami...		Potri.004G034000 [exp]	17.66	0.7475
					Potri.005G170200 [exp]	24.00	0.7378
AT1G18210			Calcium-binding EF-hand family...		Potri.014G030100 [exp]	30.59	0.7412
ATCG00350		ATCG00350.1, PS...	Photosystem I, PsaA/PsaB prote...		Potri.013G141912 [exp]	34.46	0.7286
ATCG00340		ATCG00340.1, PS...	Photosystem I, PsaA/PsaB prote...		Potri.013G142124 [exp]	54.79	0.7133
ATCG00350		ATCG00350.1, PS...	Photosystem I, PsaA/PsaB prote...		Potri.004G128501 [exp]	148.99	0.6310
ATCG00020		ATCG00020.1, PS...	photosystem II reaction center...		Potri.005G154836 [exp]	193.74	0.6488

Compare expression of checked genes

Potri.001G277301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.