Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G30000 223 / 2e-77 PHF5-like protein (.1) AT1G07170 223 / 2e-77 PHF5-like protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G072300 [exp] 223 / 2e-77 AT2G30000 223 / 3e-77 PHF5-like protein (.1) Potri.001G277800 [exp] 218 / 7e-75 AT2G30000 217 / 2e-74 PHF5-like protein (.1) Potri.009G072400 [exp] 213 / 1e-73 AT2G30000 214 / 1e-73 PHF5-like protein (.1) Potri.008G028300 [exp] 116 / 1e-35 AT2G30000 115 / 1e-35 PHF5-like protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018253 [exp] 223 / 2e-77 AT1G07170 223 / 3e-77 PHF5-like protein (.1.2.3) Lus10040654 [exp] 223 / 2e-77 AT1G07170 223 / 3e-77 PHF5-like protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03660 [poplar] [flax] PHF5 PHF5-like protein
Representative CDS sequence Show only first row Show all	>Potri.001G277700.3 pacid=42790588 polypeptide=Potri.001G277700.3.p locus=Potri.001G277700 ID=Potri.001G277700.3.v4.1 annot-version=v4.1 ATGGCCAAGCATCATCCTGATTTGATTATGTGCAGGAAGCAGCCAGGAATTGCTATTGGACGCCTTTGTGAGAAGTGTGATGGAAAATGTGTAATCTGCG ACTCCTATGTGCGTCCTTGCACACTTGTGCGAGTTTGTGATGAGTGCAACTACGGATCCTTCCAAGGTCGATGTGTTATTTGCGGAGGAGTGGGAATCTC TGATGCCTACTACTGCAAAGAGTGCACTCAGCAGGAGAAGGATAGGGATGGGTGTCCAAAAATTGTTAATTTAGGGAGTGCCAAAACAGATCTGTTCTAT GAACGTAAGAAATATGGTTTTAAGAAAAGATGA
AA sequence Show only first row Show all	>Potri.001G277700.3 pacid=42790588 polypeptide=Potri.001G277700.3.p locus=Potri.001G277700 ID=Potri.001G277700.3.v4.1 annot-version=v4.1 MAKHHPDLIMCRKQPGIAIGRLCEKCDGKCVICDSYVRPCTLVRVCDECNYGSFQGRCVICGGVGISDAYYCKECTQQEKDRDGCPKIVNLGSAKTDLFY ERKKYGFKKR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G30000			PHF5-like protein (.1)		Potri.001G277700 [exp]	0	1
AT5G59180		NRPB7	DNA-directed RNA polymerase II...		Potri.001G377200 [exp]	1.41	0.8783	RPB19.1
AT5G19180		ECR1	E1 C-terminal related 1 (.1)		Potri.010G031900 [exp]	2.00	0.8398	ECR1.2
AT4G21110			G10 family protein (.1)		Potri.009G147000 [exp]	3.16	0.8373
AT1G71750		HGPT	Hypoxanthine-guanine phosphori...		Potri.005G198400 [exp]	3.46	0.8531
AT5G09630			LisH/CRA/RING-U-box domains-co...		Potri.001G286300 [exp]	3.74	0.8224
AT4G28830			S-adenosyl-L-methionine-depend...		Potri.018G083800 [exp]	4.24	0.8239
AT5G60230		ATSEN2, SEN2	splicing endonuclease 2 (.1.2)		Potri.009G131500 [exp]	7.74	0.8136	Pt-SEN1.2
AT1G69390		ARC12, ATMINE1	accumulation and replication o...		Potri.010G162600 [exp]	8.77	0.7968
AT5G12240			unknown protein		Potri.009G069000 [exp]	9.00	0.8415
AT3G53340	CCAAT	NF-YB10	"nuclear factor Y, subunit B10...		Potri.016G085000 [exp]	10.67	0.7803

Compare expression of checked genes

Potri.001G277700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.