Potri.001G279500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G51780 210 / 2e-67 ATBAG4 BCL-2-associated athanogene 4 (.1)
AT5G07220 163 / 8e-49 ATBAG3 BCL-2-associated athanogene 3 (.1)
AT5G52060 163 / 2e-48 ATBAG1 BCL-2-associated athanogene 1 (.1)
AT5G62100 162 / 2e-48 ATBAG2 BCL-2-associated athanogene 2 (.1.2.3)
AT5G14360 116 / 3e-32 Ubiquitin-like superfamily protein (.1)
AT5G40630 110 / 4e-30 Ubiquitin-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G074300 426 / 2e-152 AT3G51780 196 / 4e-62 BCL-2-associated athanogene 4 (.1)
Potri.016G121200 216 / 7e-70 AT3G51780 218 / 1e-70 BCL-2-associated athanogene 4 (.1)
Potri.001G358200 181 / 2e-56 AT5G07220 207 / 9e-66 BCL-2-associated athanogene 3 (.1)
Potri.015G135500 181 / 5e-55 AT5G52060 303 / 2e-101 BCL-2-associated athanogene 1 (.1)
Potri.012G133400 176 / 2e-53 AT5G52060 305 / 2e-102 BCL-2-associated athanogene 1 (.1)
Potri.003G121500 157 / 2e-46 AT5G52060 243 / 1e-78 BCL-2-associated athanogene 1 (.1)
Potri.001G110300 155 / 2e-45 AT5G52060 239 / 2e-76 BCL-2-associated athanogene 1 (.1)
Potri.001G339100 128 / 7e-37 AT5G14360 166 / 6e-53 Ubiquitin-like superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027822 238 / 8e-78 AT3G51780 221 / 4e-71 BCL-2-associated athanogene 4 (.1)
Lus10005051 234 / 4e-75 AT3G51780 221 / 1e-69 BCL-2-associated athanogene 4 (.1)
Lus10023279 178 / 2e-55 AT5G07220 196 / 4e-62 BCL-2-associated athanogene 3 (.1)
Lus10027420 180 / 7e-55 AT5G52060 349 / 6e-120 BCL-2-associated athanogene 1 (.1)
Lus10038882 167 / 4e-50 AT5G52060 327 / 1e-111 BCL-2-associated athanogene 1 (.1)
Lus10003393 165 / 4e-50 AT3G51780 180 / 5e-56 BCL-2-associated athanogene 4 (.1)
Lus10015004 164 / 9e-49 AT5G52060 333 / 4e-114 BCL-2-associated athanogene 1 (.1)
Lus10005772 157 / 3e-46 AT5G52060 304 / 2e-102 BCL-2-associated athanogene 1 (.1)
Lus10029598 137 / 4e-39 AT5G52060 195 / 8e-61 BCL-2-associated athanogene 1 (.1)
Lus10002209 137 / 1e-38 AT3G51780 149 / 6e-43 BCL-2-associated athanogene 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00240 ubiquitin Ubiquitin family
CL0072 PF02179 BAG BAG domain
Representative CDS sequence
>Potri.001G279500.1 pacid=42792709 polypeptide=Potri.001G279500.1.p locus=Potri.001G279500 ID=Potri.001G279500.1.v4.1 annot-version=v4.1
ATGAAAAAATCAAAAAACACAGAGACAAGGGAGTCCAACTACAGGGAGATACACTGGGAACTTAGGCCTGGTGGCATGCTTGTTCAAAAGATGGATGTTG
GGGATGGTTCTTCTGGGCCTATGATCAAGATCAAGGTCTCTCATGGCTTATGTCACTATGATATTGCTGTCCCTGCTCAATCCACTTTTGGGGATTTGAA
AAAAGTCCTTGCCCATGAGACTGGTCTGGAGTCTAAGGAGCAGAGGCTATTGTTTAAAGGCAAAGAAAAGGAGAATGATGAATATCTGCACATGGTAGGT
GTAAAAGACATGTCAAAGGTGATACTTTTTGAGGATCCAGCCAGCAAAGAGAGGAAGCTTGAGGAGATGAAGAGAAATCAGGATACATTAAAAGCTTATG
AAGCTGTTGCCAGAGTGAGGGCAGAGGTTGATAAACTTTGCGAGAAGGTTGTTGCATTAGAGACAAATATTCGCAGTGGGACAAAGATTGCAGAAAAAGA
ATTTTCTGTCTTAACAGAATTGCTTATGATACAATTGCTTAAATTGGATTCAATTGAGGCAGATGGACAAGCGAAAGTGCAGAGAAAGATTGAGGTTCGT
CGAATCCAGAGCTTTGTGGACACACTCGAGAATTTGAAAGTGAGAAACTCTAAATCGTTTAGCCATAACAGCAACGCAGTATCGGTGACTACTAAATGGG
AGACATTTGCGTCTGGAGTTGGAAGCCTGAGTGCCCCTGTTCCACTACAATCTGCCACAAAACTAAATCAGGACTGGGAGCTGTTTGACTAA
AA sequence
>Potri.001G279500.1 pacid=42792709 polypeptide=Potri.001G279500.1.p locus=Potri.001G279500 ID=Potri.001G279500.1.v4.1 annot-version=v4.1
MKKSKNTETRESNYREIHWELRPGGMLVQKMDVGDGSSGPMIKIKVSHGLCHYDIAVPAQSTFGDLKKVLAHETGLESKEQRLLFKGKEKENDEYLHMVG
VKDMSKVILFEDPASKERKLEEMKRNQDTLKAYEAVARVRAEVDKLCEKVVALETNIRSGTKIAEKEFSVLTELLMIQLLKLDSIEADGQAKVQRKIEVR
RIQSFVDTLENLKVRNSKSFSHNSNAVSVTTKWETFASGVGSLSAPVPLQSATKLNQDWELFD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G51780 ATBAG4 BCL-2-associated athanogene 4 ... Potri.001G279500 0 1
AT5G43230 unknown protein Potri.008G177500 1.73 0.8945
AT1G13570 F-box/RNI-like superfamily pro... Potri.010G134200 2.00 0.8721
AT2G42410 C2H2ZnF ATZFP11, ZFP11 zinc finger protein 11 (.1) Potri.002G041700 2.44 0.8609
AT3G27200 Cupredoxin superfamily protein... Potri.001G332200 4.00 0.8540
AT1G04410 c-NAD-MDH1 cytosolic-NAD-dependent malate... Potri.002G141700 4.00 0.8628
AT1G75840 ATROP4, ATGP3, ... RHO-LIKE GTP BINDING PROTEIN 4... Potri.013G123800 5.91 0.8578
AT5G23720 PHS1 PROPYZAMIDE-HYPERSENSITIVE 1, ... Potri.015G105000 6.70 0.8628 Pt-PHS1.2
AT3G28450 Leucine-rich repeat protein ki... Potri.017G074400 7.07 0.8433
AT4G39490 CYP96A10 "cytochrome P450, family 96, s... Potri.007G080300 8.83 0.7975
AT2G21620 RD2 Adenine nucleotide alpha hydro... Potri.004G156100 11.22 0.7277

Potri.001G279500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.