Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G07050 138 / 6e-41 CCT motif family protein (.1) AT5G14370 105 / 8e-27 CCT motif family protein (.1) AT5G57180 98 / 8e-24 CIA2 chloroplast import apparatus 2 (.1.2.3) AT4G25990 96 / 3e-23 CIL CCT motif family protein (.1.2) AT1G73870 84 / 7e-19 CO COL7 B-box type zinc finger protein with CCT domain (.1) AT1G25440 83 / 2e-18 CO COL16 B-box type zinc finger protein with CCT domain (.1) AT1G49130 81 / 6e-18 CO COL8 B-box type zinc finger protein with CCT domain (.1.2) AT1G68520 79 / 4e-17 CO COL6 B-box type zinc finger protein with CCT domain (.1) AT2G24790 63 / 9e-12 CO COL3, ATCOL3 CONSTANS-like 3 (.1.2) AT5G57660 61 / 8e-11 CO COL5, ATCOL5 CONSTANS-like 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G077100 [exp] 268 / 2e-92 AT1G07050 119 / 3e-34 CCT motif family protein (.1) Potri.001G339200 [exp] 103 / 3e-26 AT5G14370 174 / 5e-52 CCT motif family protein (.1) Potri.006G075200 [exp] 101 / 9e-25 AT5G57180 267 / 5e-85 chloroplast import apparatus 2 (.1.2.3) Potri.018G142100 [exp] 100 / 3e-24 AT5G57180 160 / 5e-44 chloroplast import apparatus 2 (.1.2.3) Potri.015G054600 [exp] 88 / 4e-20 AT1G25440 272 / 2e-87 B-box type zinc finger protein with CCT domain (.1) Potri.010G125100 [exp] 86 / 2e-19 AT1G25440 311 / 3e-102 B-box type zinc finger protein with CCT domain (.1) Potri.008G120400 [exp] 85 / 4e-19 AT1G25440 314 / 2e-103 B-box type zinc finger protein with CCT domain (.1) Potri.014G134601 [exp] 63 / 1e-11 AT2G47890 174 / 4e-53 B-box type zinc finger protein with CCT domain (.1.2) Potri.006G173600 [exp] 61 / 8e-11 AT5G57660 315 / 1e-105 CONSTANS-like 5 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022311 [exp] 79 / 5e-17 AT5G14370 141 / 1e-38 CCT motif family protein (.1) Lus10014886 [exp] 79 / 5e-17 AT5G14370 152 / 3e-42 CCT motif family protein (.1) Lus10020012 [exp] 75 / 3e-15 AT5G57180 211 / 2e-60 chloroplast import apparatus 2 (.1.2.3) Lus10041449 [exp] 67 / 8e-13 AT1G25440 288 / 4e-93 B-box type zinc finger protein with CCT domain (.1) Lus10026238 [exp] 62 / 2e-11 AT5G24930 163 / 9e-48 CONSTANS-like 4 (.1) Lus10042431 [exp] 61 / 4e-11 AT5G24930 180 / 7e-55 CONSTANS-like 4 (.1) Lus10015619 [exp] 61 / 8e-11 AT5G57660 210 / 3e-64 CONSTANS-like 5 (.1) Lus10026909 [exp] 61 / 1e-10 AT5G24930 404 / 3e-140 CONSTANS-like 4 (.1) Lus10020105 [exp] 61 / 1e-10 AT5G24930 398 / 6e-138 CONSTANS-like 4 (.1) Lus10023229 [exp] 59 / 5e-10 AT5G24470 270 / 4e-85 pseudo-response regulator 5 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0281 [poplar] [flax] CCT PF06203 [poplar] [flax] CCT CCT motif
Representative CDS sequence Show only first row Show all	>Potri.001G281700.1 pacid=42792171 polypeptide=Potri.001G281700.1.p locus=Potri.001G281700 ID=Potri.001G281700.1.v4.1 annot-version=v4.1 ATGAAGTACAATTCTTTCTTAAAAAGCCCAAAGAAGGAAGAGCAAGAGGTCCCAGATACCGTTGTTCCTCAACTCTCCAACATCAAAGAAGAATCCTATG GCAATGGAGAGATTGATGTTGTGGATGAATTGGAAGGGATTTTTGGAATTGAACATGATGAGATGTTGTCAAGTGATAACATGTACGGCCAACTTGGTTG GGATTTTATGGACTTGGAGGAGTATCCAGCTGCTGAAGATGAAGAAGGATCAGAAATGTTTAAGTTTGGTGACAGCAGAAGCAGTTTCTTTGAGTTTGAA GAAAGCCATTACAGTATTGGTAAGGTTATAAAGGAAGAGAGTATTGGGTTTGGGGATGGAGATGGAGATGAGAAAGGAGTGTCTTTGAACTTGAACTTGA ACTACCAAGAGGTCTTGGAGGCATGGTCTGATCGTGGGCCACTTTTGGCCGATGATCACTCTCTTTCCACGGCAAGCAATGGCCATTATATGGGAGAGGT GCCAGTGATGGAAGAAGATAGGACAAGAAGGGAAGCAAGTGTCCTTAGATACAAAGAGAAGCGCCAGACCAGATTGTTCTCTAAGAAGATAAGATATCAA GTTCGCAAGCTCAATGCAGATAAAAGGCCTAGACTCAAGGGTCGATTTGTGAAGAGAGTTACCTGA
AA sequence Show only first row Show all	>Potri.001G281700.1 pacid=42792171 polypeptide=Potri.001G281700.1.p locus=Potri.001G281700 ID=Potri.001G281700.1.v4.1 annot-version=v4.1 MKYNSFLKSPKKEEQEVPDTVVPQLSNIKEESYGNGEIDVVDELEGIFGIEHDEMLSSDNMYGQLGWDFMDLEEYPAAEDEEGSEMFKFGDSRSSFFEFE ESHYSIGKVIKEESIGFGDGDGDEKGVSLNLNLNYQEVLEAWSDRGPLLADDHSLSTASNGHYMGEVPVMEEDRTRREASVLRYKEKRQTRLFSKKIRYQ VRKLNADKRPRLKGRFVKRVT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G07050			CCT motif family protein (.1)		Potri.001G281700 [exp]	0	1
AT1G25440	CO	COL16	B-box type zinc finger protein...		Potri.008G120400 [exp]	1.41	0.9563
AT4G32300		SD2-5	S-domain-2 5 (.1)		Potri.004G014301 [exp]	5.19	0.9551
AT3G62550			Adenine nucleotide alpha hydro...		Potri.014G122000 [exp]	5.29	0.9528
AT1G70820			phosphoglucomutase, putative /...		Potri.008G131400 [exp]	6.32	0.9517
AT1G76520			Auxin efflux carrier family pr...		Potri.001G456300 [exp]	6.48	0.9400
AT3G19360	C3HZnF		Zinc finger (CCCH-type) family...		Potri.003G061600 [exp]	6.92	0.9304
AT4G37300		MEE59	maternal effect embryo arrest ...		Potri.009G041100 [exp]	7.54	0.9293
AT1G69360			Plant protein of unknown funct...		Potri.018G020800 [exp]	8.36	0.9117
AT4G05120		FUR1, ENT3, FLU...	FUDR RESISTANT 1, EQUILIBRATIV...		Potri.011G041112 [exp]	8.36	0.9313
AT5G54770		THI4, TZ, THI1	THIAZOLE REQUIRING, THIAMINE4,...		Potri.011G025200 [exp]	8.94	0.9398

Compare expression of checked genes

Potri.001G281700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.