Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G10530 86 / 1e-20 Concanavalin A-like lectin protein kinase family protein (.1) AT5G65600 78 / 1e-17 Concanavalin A-like lectin protein kinase family protein (.1) AT5G55830 71 / 3e-15 Concanavalin A-like lectin protein kinase family protein (.1) AT3G53380 70 / 7e-15 Concanavalin A-like lectin protein kinase family protein (.1) AT5G03140 65 / 5e-13 Concanavalin A-like lectin protein kinase family protein (.1) AT5G42120 60 / 2e-11 Concanavalin A-like lectin protein kinase family protein (.1) AT5G06740 59 / 6e-11 Concanavalin A-like lectin protein kinase family protein (.1) AT3G45410 44 / 7e-06 Concanavalin A-like lectin protein kinase family protein (.1) AT5G01550 44 / 9e-06 LECRKA4.2 lectin receptor kinase a4.1 (.1) AT4G04960 44 / 9e-06 Concanavalin A-like lectin protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G283204 [exp] 199 / 8e-62 AT5G10530 472 / 3e-159 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283400 [exp] 199 / 2e-61 AT5G10530 494 / 6e-167 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283212 [exp] 197 / 2e-60 AT5G10530 385 / 3e-124 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283866 [exp] 195 / 8e-60 AT5G10530 478 / 3e-160 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283208 [exp] 195 / 8e-60 AT5G10530 478 / 3e-160 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283700 [exp] 195 / 1e-59 AT5G10530 497 / 7e-168 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283200 [exp] 178 / 5e-54 AT5G10530 382 / 8e-125 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G262866 [exp] 178 / 1e-53 AT5G10530 384 / 1e-124 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G284200 [exp] 146 / 4e-42 AT5G10530 441 / 8e-148 Concanavalin A-like lectin protein kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007079 [exp] 102 / 2e-27 AT5G10530 335 / 3e-111 Concanavalin A-like lectin protein kinase family protein (.1) Lus10020456 [exp] 105 / 4e-27 AT5G10530 519 / 1e-176 Concanavalin A-like lectin protein kinase family protein (.1) Lus10007075 [exp] 97 / 8e-25 AT5G10530 397 / 1e-133 Concanavalin A-like lectin protein kinase family protein (.1) Lus10004279 [exp] 97 / 3e-24 AT5G10530 578 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10020452 [exp] 95 / 2e-23 AT5G10530 510 / 2e-173 Concanavalin A-like lectin protein kinase family protein (.1) Lus10029555 [exp] 91 / 3e-22 AT5G10530 687 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10007077 [exp] 91 / 4e-22 AT5G10530 511 / 4e-171 Concanavalin A-like lectin protein kinase family protein (.1) Lus10007074 [exp] 89 / 1e-21 AT5G10530 426 / 4e-143 Concanavalin A-like lectin protein kinase family protein (.1) Lus10029553 [exp] 89 / 3e-21 AT5G10530 591 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10020446 [exp] 88 / 3e-21 AT5G10530 516 / 2e-175 Concanavalin A-like lectin protein kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G283500.2 pacid=42790319 polypeptide=Potri.001G283500.2.p locus=Potri.001G283500 ID=Potri.001G283500.2.v4.1 annot-version=v4.1 ATGGTGCAGTGGGTTTGGGGGCTCTATGGTGAAGGAAAGCTACTTGAAGCAGTTGAGTACCCAAGACTATGCGGAGATTTTAACAAGACGCAGATGGAAC GCTTGATGATTGTCGGCCTTTCGTGTGCTCATCCAGAACATCGTAGACCCTCAATTCGGCAAGCACTTCACGTTCTTAATTTTGATGCTCCATTGCCTAT TCTCCCATCAAAGATGCCCGTGCCGTCATATTTCGCCCCGCCAATACCTGCATCTTCACTTTCAATAATGTCCTATGGCCTTGCAGATTCTGAAGGAGGG ATGAACAAATCTTCAAGTTACAGTTACAACACTAATTCTTCCCAGTTCACCACATCTTCTTCAGCATCTTCTGCATCTGCCATGCTTCCACACGAAGGCT AA
AA sequence Show only first row Show all	>Potri.001G283500.2 pacid=42790319 polypeptide=Potri.001G283500.2.p locus=Potri.001G283500 ID=Potri.001G283500.2.v4.1 annot-version=v4.1 MVQWVWGLYGEGKLLEAVEYPRLCGDFNKTQMERLMIVGLSCAHPEHRRPSIRQALHVLNFDAPLPILPSKMPVPSYFAPPIPASSLSIMSYGLADSEGG MNKSSSYSYNTNSSQFTTSSSASSASAMLPHEG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G10530			Concanavalin A-like lectin pro...		Potri.001G283500 [exp]	0	1
AT4G02860			Phenazine biosynthesis PhzC/Ph...		Potri.010G175701 [exp]	10.48	0.8306
AT4G02860			Phenazine biosynthesis PhzC/Ph...		Potri.010G175700 [exp]	15.62	0.8393
AT5G60900		RLK1	receptor-like protein kinase 1...		Potri.003G211700 [exp]	25.98	0.7824
AT1G34300			lectin protein kinase family p...		Potri.016G102500 [exp]	34.05	0.8086
AT1G68450		PDE337	PIGMENT DEFECTIVE 337, VQ moti...		Potri.010G123700 [exp]	41.95	0.7898
AT1G77210		AtSTP14	sugar transport protein 14, su...		Potri.001G253800 [exp]	54.49	0.7572
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Potri.004G025800 [exp]	55.58	0.7700
AT1G78380		GST8, ATGSTU19	GLUTATHIONE TRANSFERASE 8, A. ...		Potri.001G437200 [exp]	79.59	0.7610
AT2G38740			Haloacid dehalogenase-like hyd...		Potri.001G147400 [exp]	80.16	0.7391
AT1G29750		RKF1	receptor-like kinase in flower...		Potri.011G072300 [exp]	85.80	0.7684

Compare expression of checked genes

Potri.001G283500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.