Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G47960 59 / 2e-11 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1) AT3G17152 39 / 0.0002 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G083500 [exp] 142 / 2e-44 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.010G063000 [exp] 89 / 1e-23 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.008G102600 [exp] 57 / 3e-11 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003530 [exp] 84 / 2e-21 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10002933 [exp] 81 / 2e-20 AT1G47960 89 / 3e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10017013 [exp] 56 / 2e-10 AT1G47960 112 / 4e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10037792 [exp] 55 / 3e-10 AT1G47960 91 / 1e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10016317 [exp] 55 / 3e-10 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10027947 [exp] 55 / 4e-10 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10017076 [exp] 53 / 2e-09 AT1G47960 88 / 9e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10037791 [exp] 52 / 3e-09 AT3G17130 131 / 8e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10000822 [exp] 52 / 3e-09 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G288500.1 pacid=42790195 polypeptide=Potri.001G288500.1.p locus=Potri.001G288500 ID=Potri.001G288500.1.v4.1 annot-version=v4.1 ATGATTCGCACCATCAACGCTAGGGCATGCAAGCCACACACTACACCGCTGCTTGATCATGAATATAAAGACGACACAAATATGAAACAAGCCTTACAAT CTTGTGCTGATCAATACGATGCTATAATAAAGGGAGACATTCCACTGTCTCTAAAAGCTTTGCGTTCGGGTGACTACAAATTTTCTGAACGAGGCACAAT GGATGCTGCTGTTGAGGCCGGGCCATGTGAAAAAGAATTCACAACCAGATGCAGGTCGCCCCTTTCTGATATGAATAGAGTTGTGCATGATGTCTCCGTC GTGGCTGCATCCATTGTTAAGACGATGATAACATCTTAA
AA sequence Show only first row Show all	>Potri.001G288500.1 pacid=42790195 polypeptide=Potri.001G288500.1.p locus=Potri.001G288500 ID=Potri.001G288500.1.v4.1 annot-version=v4.1 MIRTINARACKPHTTPLLDHEYKDDTNMKQALQSCADQYDAIIKGDIPLSLKALRSGDYKFSERGTMDAAVEAGPCEKEFTTRCRSPLSDMNRVVHDVSV VAASIVKTMITS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Potri.001G288500 [exp]	0	1
					Potri.001G073166 [exp]	5.47	0.9418
AT1G07390		AtRLP1	receptor like protein 1 (.1.2....		Potri.018G120700 [exp]	7.41	0.9203
AT2G41810			Protein of unknown function, D...		Potri.006G050400 [exp]	8.12	0.9367
AT1G21695			hydroxyproline-rich glycoprote...		Potri.005G181200 [exp]	10.58	0.9288
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Potri.011G076500 [exp]	10.58	0.9359
AT4G22165			F-box family protein with a do...		Potri.004G137700 [exp]	10.95	0.9185
					Potri.010G072200 [exp]	12.96	0.9055
					Potri.018G145526 [exp]	13.41	0.9204
AT3G02885		GASA5	GAST1 protein homolog 5 (.1)		Potri.017G124200 [exp]	13.96	0.9129	Pt-GASA5.2
AT2G28690			Protein of unknown function (D...		Potri.001G235200 [exp]	14.69	0.8532

Compare expression of checked genes

Potri.001G288500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.