Plant FIBer expression Database

Potri.001G291033 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G14930 84 / 2e-19 GENE101, SAG101 senescence-associated gene 101 (.1.2.3)
AT3G52430 40 / 0.0005 PAD4, ATPAD4 ARABIDOPSIS PHYTOALEXIN DEFICIENT 4, alpha/beta-Hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G290600
[exp]
265 / 6e-87 AT5G14930 328 / 2e-105 senescence-associated gene 101 (.1.2.3)
Potri.009G086100
[exp]
220 / 2e-69 AT5G14930 309 / 4e-98 senescence-associated gene 101 (.1.2.3)
Potri.001G291166
[exp]
192 / 1e-64 AT5G14930 55 / 3e-10 senescence-associated gene 101 (.1.2.3)
Potri.019G005256
[exp]
195 / 6e-60 AT5G14930 317 / 3e-101 senescence-associated gene 101 (.1.2.3)
Potri.019G007227
[exp]
175 / 2e-52 AT5G14930 300 / 3e-94 senescence-associated gene 101 (.1.2.3)
Potri.005G068700
[exp]
44 / 3e-05 AT3G52430 327 / 2e-104 ARABIDOPSIS PHYTOALEXIN DEFICIENT 4, alpha/beta-Hydrolases superfamily protein (.1)
Potri.007G100600
[exp]
42 / 0.0001 AT3G52430 320 / 4e-102 ARABIDOPSIS PHYTOALEXIN DEFICIENT 4, alpha/beta-Hydrolases superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039444
[exp]
126 / 5e-34 AT3G01380 1238 / 0.0 transferases;sulfuric ester hydrolases;catalytics;transferases (.1)
Lus10011697
[exp]
122 / 5e-33 AT5G14930 255 / 4e-78 senescence-associated gene 101 (.1.2.3)
Lus10009502
[exp]
119 / 2e-31 AT5G14930 299 / 5e-94 senescence-associated gene 101 (.1.2.3)
Lus10014518
[exp]
116 / 1e-30 AT5G14930 298 / 2e-93 senescence-associated gene 101 (.1.2.3)
Lus10032169
[exp]
107 / 2e-27 AT5G14930 314 / 7e-100 senescence-associated gene 101 (.1.2.3)
Lus10039617
[exp]
50 / 3e-07 AT3G52430 375 / 1e-122 ARABIDOPSIS PHYTOALEXIN DEFICIENT 4, alpha/beta-Hydrolases superfamily protein (.1)
Lus10029534
[exp]
49 / 7e-07 AT3G52430 349 / 2e-112 ARABIDOPSIS PHYTOALEXIN DEFICIENT 4, alpha/beta-Hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence
>Potri.001G291033.1 pacid=42789088 polypeptide=Potri.001G291033.1.p locus=Potri.001G291033 ID=Potri.001G291033.1.v4.1 annot-version=v4.1
ATGAACTGCATGAAGGGTATGATTATTGAGTTGCTGCAGAACTCAAACAGCAAGATAAGTTTTTTCTTTTTGCAAAAGTGTTCTTCTTGTCCTCGTTCTC
AATTAACTAAACATTATATTCTGCTGGAGCAATGGCAAAAGGAGCATACAGAAAAACTTGCAGTCGCACCAAACGATAAGAAGAAACAAAATGTGGCTGG
TAGTCTTACTGAGGATTCTTGCTTTTGGATGAATGTGGAGGAGGCTCTCATTTCTTGCAAACAGTTGAAGGATGGAAGTAATGTAGAGAAACAATCAGCG
AGAGAGCGTCTGAATATGTTTGAGCAGTATGTGATGGACCAAATCAATAACTATGCAGTATCTCCTGACATTTTCTTGGAAAAAAGCAGTTTTATGAATT
GGTGGAAAGATTTTCAGGAAATCATAGAAACATCCCATGATTCTCCTCTCAGAGGCTTCATGAAGATATGCAGATATCGCCAATATGAAAAGGGGAAGTT
TTAG
AA sequence
>Potri.001G291033.1 pacid=42789088 polypeptide=Potri.001G291033.1.p locus=Potri.001G291033 ID=Potri.001G291033.1.v4.1 annot-version=v4.1
MNCMKGMIIELLQNSNSKISFFFLQKCSSCPRSQLTKHYILLEQWQKEHTEKLAVAPNDKKKQNVAGSLTEDSCFWMNVEEALISCKQLKDGSNVEKQSA
RERLNMFEQYVMDQINNYAVSPDIFLEKSSFMNWWKDFQEIIETSHDSPLRGFMKICRYRQYEKGKF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G14930 GENE101, SAG101 senescence-associated gene 101... Potri.001G291033
[exp]
0 1
AT5G36930 Disease resistance protein (TI... Potri.011G008164
[exp]
13.15 0.8865
AT1G27170 transmembrane receptors;ATP bi... Potri.006G282100
[exp]
22.18 0.8749
AT1G58400 Disease resistance protein (CC... Potri.010G044601
[exp]
23.17 0.8796
AT3G14470 NB-ARC domain-containing disea... Potri.012G123000
[exp]
43.41 0.8682
AT3G50160 Plant protein of unknown funct... Potri.016G039100
[exp]
47.54 0.8669
AT3G14470 NB-ARC domain-containing disea... Potri.012G122200
[exp]
49.59 0.8614
AT4G10780 LRR and NB-ARC domains-contain... Potri.017G035300
[exp]
50.73 0.8655
AT5G17680 disease resistance protein (TI... Potri.019G070565
[exp]
55.89 0.8690
Potri.005G108850
[exp]
58.37 0.8561
AT1G27170 transmembrane receptors;ATP bi... Potri.011G012801
[exp]
77.48 0.8507

Potri.001G291033 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.