Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G49975 154 / 2e-49 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G086400 [exp] 100 / 1e-28 AT1G49975 82 / 1e-21 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006137 [exp] 160 / 2e-51 AT1G49975 155 / 6e-50 unknown protein Lus10033771 [exp] 149 / 2e-47 AT1G49975 157 / 2e-50 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05479 [poplar] [flax] PsaN Photosystem I reaction centre subunit N (PSAN or PSI-N)
Representative CDS sequence Show only first row Show all	>Potri.001G292000.1 pacid=42792477 polypeptide=Potri.001G292000.1.p locus=Potri.001G292000 ID=Potri.001G292000.1.v4.1 annot-version=v4.1 ATGAGTTCAATATCCCAAAGTGTGTTGATGGCACTGACCGTTACATTCAACAAGTTTGCTTCGTCAAATGTTAATGCAGTTCATAAAAAAGAAAGTAAAA GAGCAGCTGCAGCAACAACAGCTAAAGCAGCAAGCAGGGCAGCTGACATTGGAAGAAGAGGAGTCCTCTTATCCACCGTGGTTGGTGTATATTCAGTCAA TGACTCAAGGATTGAACTTCTTAAAAAATATTTGAAGAAATCAGAGGATAACAAGACCAAAAATGACAAGGAGAGAATGGATAGCTATTACAAGCGGAAC TACAAGGATTATTTTGACTTTGTGGAAGGATCTTTGAAAGGGAAGAATGAGCAGGACCTTACTGAATCAGAGAAGGGTATTCTTGATTGGCTAAAGAAAA ATAAATAA
AA sequence Show only first row Show all	>Potri.001G292000.1 pacid=42792477 polypeptide=Potri.001G292000.1.p locus=Potri.001G292000 ID=Potri.001G292000.1.v4.1 annot-version=v4.1 MSSISQSVLMALTVTFNKFASSNVNAVHKKESKRAAAATTAKAASRAADIGRRGVLLSTVVGVYSVNDSRIELLKKYLKKSEDNKTKNDKERMDSYYKRN YKDYFDFVEGSLKGKNEQDLTESEKGILDWLKKNK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G49975			unknown protein		Potri.001G292000 [exp]	0	1
AT1G78995			unknown protein		Potri.007G003600 [exp]	1.00	0.9868
AT3G27160		GHS1	GLUCOSE HYPERSENSITIVE 1, Ribo...		Potri.001G331600 [exp]	1.41	0.9857	GHS1.1
					Potri.004G068600 [exp]	2.44	0.9830
AT2G33450			Ribosomal L28 family (.1)		Potri.008G169800 [exp]	5.09	0.9771
AT1G68010		ATHPR1, HPR	hydroxypyruvate reductase (.1....		Potri.004G175800 [exp]	6.32	0.9794	Pt-HPR.1
AT5G66530			Galactose mutarotase-like supe...		Potri.007G023200 [exp]	8.48	0.9646
AT4G34190		SEP1	stress enhanced protein 1 (.1)		Potri.001G301100 [exp]	8.77	0.9773	SEP1.1
AT3G55800		SBPASE	sedoheptulose-bisphosphatase (...		Potri.008G063800 [exp]	8.94	0.9778
AT3G26650		GAPA-1, GAPA	GLYCERALDEHYDE 3-PHOSPHATE DEH...		Potri.014G140500 [exp]	9.48	0.9779
AT2G39730		RCA	rubisco activase (.1.2.3)		Potri.008G058500 [exp]	9.48	0.9747	RCA.2

Compare expression of checked genes

Potri.001G292000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.