Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G49970 307 / 4e-105 SVR2, NCLPP5, CLPR1 SUPPRESSOR OF VARIEGATION 2, NUCLEAR CLPP 5, CLP protease proteolytic subunit 1 (.1) AT1G09130 128 / 5e-36 ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.1), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.2), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.3) AT4G17040 127 / 7e-36 HON5, CLPR4 happy on norflurazon 5, CLP protease R subunit 4 (.1) AT1G12410 97 / 1e-24 EMB3146, CLP2, NCLPP2, CLPR2 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) AT5G23140 93 / 3e-23 NCLPP7, NCLPP2, CLPP2 nuclear-encoded CLP protease P7 (.1) AT5G45390 90 / 9e-22 NCLPP3, NCLPP4, CLPP4 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) AT1G66670 84 / 2e-19 NCLPP3, NCLPP4, CLPP3 CLP protease proteolytic subunit 3 (.1) AT1G02560 84 / 2e-19 NCLPP5, NCLPP1, CLPP5 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) ATCG00670 62 / 4e-12 PCLPP, ATCG00670.1, CLPP1 CASEINOLYTIC PROTEASE P 1, plastid-encoded CLP P (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G089300 [exp] 374 / 2e-131 AT1G49970 459 / 7e-162 SUPPRESSOR OF VARIEGATION 2, NUCLEAR CLPP 5, CLP protease proteolytic subunit 1 (.1) Potri.003G083300 [exp] 130 / 6e-37 AT4G17040 441 / 2e-157 happy on norflurazon 5, CLP protease R subunit 4 (.1) Potri.013G017166 [exp] 129 / 4e-36 AT1G09130 451 / 2e-159 ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.1), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.2), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.3) Potri.004G092100 [exp] 94 / 6e-23 AT1G66670 441 / 2e-156 CLP protease proteolytic subunit 3 (.1) Potri.005G092600 [exp] 92 / 6e-23 AT5G23140 380 / 3e-135 nuclear-encoded CLP protease P7 (.1) Potri.007G071700 [exp] 92 / 2e-22 AT5G23140 383 / 1e-135 nuclear-encoded CLP protease P7 (.1) Potri.001G115900 [exp] 89 / 1e-21 AT1G12410 408 / 3e-145 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) Potri.002G195200 [exp] 85 / 7e-20 AT1G02560 474 / 2e-170 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Potri.014G119700 [exp] 85 / 9e-20 AT1G02560 493 / 6e-178 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003953 [exp] 186 / 3e-58 AT1G49970 318 / 8e-107 SUPPRESSOR OF VARIEGATION 2, NUCLEAR CLPP 5, CLP protease proteolytic subunit 1 (.1) Lus10020990 [exp] 186 / 9e-58 AT1G49970 308 / 1e-102 SUPPRESSOR OF VARIEGATION 2, NUCLEAR CLPP 5, CLP protease proteolytic subunit 1 (.1) Lus10029891 [exp] 100 / 2e-24 AT3G05510 255 / 1e-79 Phospholipid/glycerol acyltransferase family protein (.1.2) Lus10017397 [exp] 93 / 4e-23 AT5G23140 394 / 1e-140 nuclear-encoded CLP protease P7 (.1) Lus10010196 [exp] 92 / 8e-23 AT5G23140 395 / 4e-141 nuclear-encoded CLP protease P7 (.1) Lus10040982 [exp] 88 / 5e-21 AT5G23140 338 / 5e-118 nuclear-encoded CLP protease P7 (.1) Lus10010979 [exp] 87 / 3e-20 AT1G66670 288 / 6e-97 CLP protease proteolytic subunit 3 (.1) Lus10000449 [exp] 87 / 3e-20 AT1G66670 285 / 1e-95 CLP protease proteolytic subunit 3 (.1) Lus10040981 [exp] 85 / 9e-20 AT5G23140 350 / 1e-122 nuclear-encoded CLP protease P7 (.1) Lus10007589 [exp] 84 / 1e-19 AT5G45390 293 / 2e-99 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0127 [poplar] [flax] ClpP_crotonase PF00574 [poplar] [flax] CLP_protease Clp protease
Representative CDS sequence Show only first row Show all	>Potri.001G295266.2 pacid=42790028 polypeptide=Potri.001G295266.2.p locus=Potri.001G295266 ID=Potri.001G295266.2.v4.1 annot-version=v4.1 ATGTATTTGGATTATGATGATCCTTCAAAGCCTATTTATCTATATATAAACTCATCCGGGACACAGAATGAGAAGATGGAGACTGTCGGATCCGAAACTG AAGCGTATGCCATTGCAGACACCATGTCTTACTGCAAATCAACTATCTATACTGTGAATTGTGGCATGGCATATGGTCAAGCAGCAATGCTTCTATCTCT TGGAGCCAAGGGTTATCGCGCCTTACAGCCAAACTCATCCACAAAATTATATTTGCCTAAAGTCAACAGATCAAGCGGAGCTGCAGTAGATATGTGGATC AAGGCCAAGGAATTGGATGCAAATACTGAGTATTATATTGAGCTGTTAGCAAAAGGAACTGGGAAGCCGAAGGAAGAACTTGTTAAAGACATCCAGCGAC CAAAATATCTCAAAGCTCAGGAAGCCATAGATTATGGGATTGCCGACAAACTACTTAGCTCAAGTGATGATGCATTTGAGAAAAGGGACTATGATGCATT ACTTGCTCAAACAAAAGCCATGAAGGCACAAGCTGCTGGGCCAAGAGCAGCTCGCTCTGGTTTTAGATGA
AA sequence Show only first row Show all	>Potri.001G295266.2 pacid=42790028 polypeptide=Potri.001G295266.2.p locus=Potri.001G295266 ID=Potri.001G295266.2.v4.1 annot-version=v4.1 MYLDYDDPSKPIYLYINSSGTQNEKMETVGSETEAYAIADTMSYCKSTIYTVNCGMAYGQAAMLLSLGAKGYRALQPNSSTKLYLPKVNRSSGAAVDMWI KAKELDANTEYYIELLAKGTGKPKEELVKDIQRPKYLKAQEAIDYGIADKLLSSSDDAFEKRDYDALLAQTKAMKAQAAGPRAARSGFR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G49970		SVR2, NCLPP5, C...	SUPPRESSOR OF VARIEGATION 2, N...		Potri.001G295266 [exp]	0	1
AT5G63890		HISN8, ATHDH	HISTIDINE BIOSYNTHESIS 8, hist...		Potri.011G163400 [exp]	2.44	0.8235
AT3G10140		RECA3	RECA homolog 3 (.1)		Potri.016G057700 [exp]	3.74	0.8414
AT3G04460		PEX12, ATPEX12,...	ABERRANT PEROXISOME MORPHOLOGY...		Potri.013G047800 [exp]	8.48	0.7919
AT1G17330			Metal-dependent phosphohydrola...		Potri.007G072000 [exp]	8.60	0.7606
AT5G24670		TAD3, EMB2820	tRNA adenosine deaminase 3, EM...		Potri.013G094800 [exp]	18.57	0.8284
AT4G19540		INDH, INDL	IND1(iron-sulfur protein requi...		Potri.002G042600 [exp]	22.36	0.7431
AT2G20770		GCL2	GCR2-like 2 (.1)		Potri.013G134700 [exp]	27.00	0.8197
AT2G46580			Pyridoxamine 5'-phosphate oxid...		Potri.014G100700 [exp]	31.63	0.7541
AT3G59580		NLP9	Plant regulator RWP-RK family ...		Potri.017G020398 [exp]	35.29	0.8208
AT4G13720			Inosine triphosphate pyrophosp...		Potri.003G175800 [exp]	39.93	0.7381

Compare expression of checked genes

Potri.001G295266 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.