Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G14860 300 / 7e-103 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT4G33905 298 / 5e-102 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT5G43140 250 / 2e-83 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT5G19750 102 / 1e-25 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT4G03410 78 / 1e-16 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) AT2G42770 74 / 1e-15 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT1G52870 75 / 3e-15 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) AT3G24570 68 / 3e-13 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) AT4G04470 59 / 2e-10 PMP22 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT4G14305 57 / 1e-09 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G090600 [exp] 422 / 5e-151 AT4G33905 299 / 1e-102 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.014G017800 [exp] 167 / 5e-52 AT5G43140 183 / 2e-58 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.006G032500 [exp] 103 / 4e-26 AT5G19750 279 / 8e-94 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.016G029700 [exp] 99 / 2e-24 AT5G19750 257 / 5e-85 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.018G037100 [exp] 82 / 8e-19 AT3G24570 289 / 6e-100 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.018G081600 [exp] 76 / 2e-16 AT3G24570 309 / 7e-108 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.010G032900 [exp] 74 / 2e-15 AT2G42770 271 / 9e-93 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.001G404600 [exp] 71 / 9e-14 AT1G52870 438 / 6e-154 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.011G123700 [exp] 69 / 3e-13 AT1G52870 472 / 1e-167 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002118 [exp] 317 / 3e-109 AT2G14860 292 / 6e-100 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10011424 [exp] 308 / 7e-106 AT2G14860 288 / 3e-98 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10018700 [exp] 237 / 1e-76 AT5G43140 253 / 2e-83 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10007761 [exp] 200 / 1e-61 AT5G43140 223 / 1e-70 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10039003 [exp] 93 / 2e-22 AT5G19750 241 / 1e-79 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10012098 [exp] 88 / 3e-20 AT5G19750 259 / 4e-86 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10010446 [exp] 86 / 1e-19 AT5G19750 258 / 2e-86 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10034922 [exp] 79 / 3e-17 AT3G24570 330 / 4e-116 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10023648 [exp] 79 / 3e-17 AT3G24570 330 / 6e-116 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10001421 [exp] 78 / 5e-16 AT2G42770 274 / 7e-90 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04117 [poplar] [flax] Mpv17_PMP22 Mpv17 / PMP22 family
Representative CDS sequence Show only first row Show all	>Potri.001G296400.1 pacid=42789525 polypeptide=Potri.001G296400.1.p locus=Potri.001G296400 ID=Potri.001G296400.1.v4.1 annot-version=v4.1 ATGAGCGGCTCATTCATGAGAAACTCCACCATCCCCCGCCTGTTACGCGCCCACACCATCACCAACATCACAGACCCAGCAGCAACAGCAGCTCATTCGG TTTTCAGACAACAACAACAGTCAAGAAAAGCTTACTTTGGTTTCTCAAATGGTTTTAAGAGATCAAAGGAGTGCAATAATGAGCTCTCTCCTTCTTCTCT TTTGACTTCTTCTTTCTCTTCAAAGGCTGAAAACGCTGCGTTTTACAAAATTGGGTTTATTGGTTGGTACCTGGGGATGGTTAAGTCACGGCCTATCTTG ACCAAAAGTGCCACTTCTTCTCTTATTTACATTGCTGCTGACTTGTCGTCTCAGACAATTTCACTGCCAAGTTCGGAACCTTATGATCTGGTGAGGACAT TGCGCATGGCTGGATATGGGTTGCTGATTGTAGGACCATCACTGCATTTTTGGTTCAAATTTGTCTCAAAACTCCTTCCAAAAAGAGATCTAATCACGAC ATTTAAGAAAATTCTCATGGGTCAGACCATCTACGGACCTATCATGACTGTTGTTTTCTTCTCATTGAATGCACGCCTACAGGGTGAGAATAGTGCCGAG ATTATTGCCCGGTTAAAGCGAGATTTAGTGCCTACAATGATAAACGGTGTTATGTACTGGCCTGTATGTGATTTTGTAACATTCAAATTCATTCCTGTCC ATTTACAGCCCTTGGTGAGCAACTCGTTTTCATATCTATGGACTGTCTACATGACATACATGGCAAGTTTAGAGAAAGCAGGCTCCTCCGGATGA
AA sequence Show only first row Show all	>Potri.001G296400.1 pacid=42789525 polypeptide=Potri.001G296400.1.p locus=Potri.001G296400 ID=Potri.001G296400.1.v4.1 annot-version=v4.1 MSGSFMRNSTIPRLLRAHTITNITDPAATAAHSVFRQQQQSRKAYFGFSNGFKRSKECNNELSPSSLLTSSFSSKAENAAFYKIGFIGWYLGMVKSRPIL TKSATSSLIYIAADLSSQTISLPSSEPYDLVRTLRMAGYGLLIVGPSLHFWFKFVSKLLPKRDLITTFKKILMGQTIYGPIMTVVFFSLNARLQGENSAE IIARLKRDLVPTMINGVMYWPVCDFVTFKFIPVHLQPLVSNSFSYLWTVYMTYMASLEKAGSSG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G14860			Peroxisomal membrane 22 kDa (M...		Potri.001G296400 [exp]	0	1
AT5G40370		GRXC2	glutaredoxin C2, Glutaredoxin ...		Potri.001G347700 [exp]	3.87	0.8018	PtrcGrx_C2
AT2G46580			Pyridoxamine 5'-phosphate oxid...		Potri.002G173800 [exp]	4.89	0.8226
AT4G16520		ATG8F	autophagy 8f, Ubiquitin-like s...		Potri.014G060300 [exp]	5.47	0.7865
AT1G07870			Protein kinase superfamily pro...		Potri.009G026500 [exp]	8.36	0.7480
AT5G16940			carbon-sulfur lyases (.1.2)		Potri.017G132000 [exp]	10.00	0.7388
AT5G39250			F-box family protein (.1)		Potri.004G119500 [exp]	14.31	0.7145
AT3G15518			unknown protein		Potri.011G123600 [exp]	17.32	0.7739
AT3G24170		ATGR1	glutathione-disulfide reductas...		Potri.001G050000 [exp]	20.63	0.6612	Pt-GR.2,PtrcGR2
AT2G16430		ATPAP10, PAP10	purple acid phosphatase 10 (.1...		Potri.009G121200 [exp]	21.84	0.7049
AT3G55730	MYB	ATMYB109	myb domain protein 109 (.1)		Potri.010G195000 [exp]	22.75	0.7176

Compare expression of checked genes

Potri.001G296400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.