Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33910 441 / 5e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G23096 312 / 3e-107 P4H13 prolyl 4-hydroxylase 13, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G66060 194 / 1e-60 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G20270 188 / 2e-58 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G28480 179 / 1e-54 Oxoglutarate/iron-dependent oxygenase (.1.2) AT2G17720 175 / 2e-53 P4H5 prolyl 4-hydroxylase 5, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G35810 173 / 2e-52 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G28490 172 / 3e-52 Oxoglutarate/iron-dependent oxygenase (.1) AT5G18900 160 / 1e-47 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G06300 158 / 1e-46 P4H2, AT-P4H-2 prolyl 4-hydroxylase 2, P4H isoform 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G091000 [exp] 515 / 0 AT4G33910 431 / 9e-154 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.007G052600 [exp] 369 / 3e-129 AT4G33910 353 / 4e-123 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G108000 [exp] 187 / 4e-58 AT5G66060 405 / 1e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.005G245300 [exp] 183 / 2e-56 AT1G20270 483 / 3e-174 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.007G060800 [exp] 182 / 2e-55 AT5G66060 349 / 6e-121 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.017G075100 [exp] 181 / 2e-55 AT3G28480 436 / 3e-155 Oxoglutarate/iron-dependent oxygenase (.1.2) Potri.008G197700 [exp] 180 / 3e-55 AT5G18900 448 / 3e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.017G075300 [exp] 171 / 4e-52 AT3G28480 345 / 5e-120 Oxoglutarate/iron-dependent oxygenase (.1.2) Potri.002G232100 [exp] 149 / 4e-43 AT2G43080 456 / 4e-164 P4H isoform 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011085 [exp] 234 / 3e-76 AT4G33910 241 / 4e-79 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10028404 [exp] 188 / 3e-58 AT5G66060 486 / 8e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10041857 [exp] 187 / 4e-58 AT5G66060 488 / 2e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10032183 [exp] 177 / 1e-53 AT3G28480 434 / 3e-154 Oxoglutarate/iron-dependent oxygenase (.1.2) Lus10016271 [exp] 173 / 3e-52 AT5G18900 444 / 2e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10012014 [exp] 172 / 3e-52 AT5G18900 448 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10014502 [exp] 170 / 3e-51 AT3G28480 398 / 4e-140 Oxoglutarate/iron-dependent oxygenase (.1.2) Lus10005620 [exp] 160 / 3e-47 AT1G20270 465 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10031048 [exp] 152 / 1e-44 AT2G43080 406 / 7e-145 P4H isoform 1 (.1) Lus10017249 [exp] 146 / 3e-41 AT1G20270 455 / 3e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF13640 [poplar] [flax] 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Potri.001G296800.1 pacid=42789854 polypeptide=Potri.001G296800.1.p locus=Potri.001G296800 ID=Potri.001G296800.1.v4.1 annot-version=v4.1 ATGAAAATCAAAACGAAAAGATCAAAAAGAAAGCTAGGGTTACCAGCTGCAATACTTCTTTGCTCTTTGTTCTTTCTTGGGGGTCTATACAGCTCTACTT TTATCTCCAACGATGTCCCGGTCATTAAACCAAGGTTAAGAATGCTTGAAGTAGCGGAAGTGGATCATGACGCGATGCCGCATGGGGATACTGGCGAAGC TTTTATTGAATCCATCCCTTTTCAGGTTTTAAGTTGGAAACCAAGAGCACTTTATTTCCCGAACTTTGCGACTCCTGAACAATGTGAAAGCATCATTAAA ATGGCAAAATCTAAATTGAAACCATCTACTTTAGCTTTGCGAAAGGGAGAAACTACTGAGAGTACTAAAGGAACTAGAACAAGTTCAGGCACATTTATTG GTGGTTCAGAAGATAAAACTGGAACCTTGGACTTCATTGAGCGGAAAATTGCAAAGGCTACAATGATCCCACAATCACATGGAGAGGCATTCAATATCTT GCGTTATGAAATCGGGCAGAAGTATGATTCACATTATGATGCATTTAACCCAGATGAATATGGTCCACAGCCAAGCCAAAGGGTTGCTTCTTTCTTGTTG TATCTGTCTAGTGTGGAAGAAGGTGGAGAAACCATGTTCCCCTTTGAGAATGGCTCTGCAGTAAGTTCTGGCTTTGAGTACAAGCAATGTGTTGGTTTGA AAGTGAAGCCTCGGCAAGGTGATGGACTTCTATTTTACTCGTTGTTTCCAAATGGAACCATTGATCGGACATCTCTCCACGGAAGCTGTCCAGTTATCAA AGGGGAGAAATGGGTGGCAACGAAGTGGATTAGAGATCAAATGGAACTGGACTAG
AA sequence Show only first row Show all	>Potri.001G296800.1 pacid=42789854 polypeptide=Potri.001G296800.1.p locus=Potri.001G296800 ID=Potri.001G296800.1.v4.1 annot-version=v4.1 MKIKTKRSKRKLGLPAAILLCSLFFLGGLYSSTFISNDVPVIKPRLRMLEVAEVDHDAMPHGDTGEAFIESIPFQVLSWKPRALYFPNFATPEQCESIIK MAKSKLKPSTLALRKGETTESTKGTRTSSGTFIGGSEDKTGTLDFIERKIAKATMIPQSHGEAFNILRYEIGQKYDSHYDAFNPDEYGPQPSQRVASFLL YLSSVEEGGETMFPFENGSAVSSGFEYKQCVGLKVKPRQGDGLLFYSLFPNGTIDRTSLHGSCPVIKGEKWVATKWIRDQMELD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G33910			2-oxoglutarate (2OG) and Fe(II...		Potri.001G296800 [exp]	0	1
AT5G47780		GAUT4	galacturonosyltransferase 4 (....		Potri.016G001700 [exp]	31.38	0.7268
AT1G43580			Sphingomyelin synthetase famil...		Potri.002G066900 [exp]	55.28	0.7070
AT1G11400		PYM	partner of Y14-MAGO (.1.2.3)		Potri.003G021500 [exp]	74.22	0.7052
AT1G03950		VPS2.3	vacuolar protein sorting-assoc...		Potri.005G227000 [exp]	78.00	0.6493
AT2G41835	C2H2ZnF		zinc finger (C2H2 type, AN1-li...		Potri.006G052200 [exp]	80.42	0.6353
AT1G33470			RNA-binding (RRM/RBD/RNP motif...		Potri.013G094400 [exp]	110.66	0.6490
AT2G44525			Protein of unknown function (D...		Potri.014G179500 [exp]	127.89	0.6640
AT5G54380		THE1	THESEUS1, protein kinase famil...		Potri.011G128000 [exp]	130.76	0.6584
AT4G13720			Inosine triphosphate pyrophosp...		Potri.001G052400 [exp]	172.07	0.6379
AT4G18800		AthSGBP, AtRab1...	RAB GTPase homolog A1D (.1)		Potri.004G061000 [exp]	174.49	0.6451

Compare expression of checked genes

Potri.001G296800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.