Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G25580 291 / 7e-101 Thioredoxin superfamily protein (.1) AT2G18990 285 / 2e-98 TXND9 thioredoxin domain-containing protein 9 homolog (.1) AT5G66410 114 / 2e-31 PLP3B phosducin-like protein 3 homolog (.1) AT3G50960 114 / 4e-31 PLP3A phosducin-like protein 3 homolog (.1) AT3G17880 46 / 9e-06 ATHIP2, ATTDX HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) AT5G39950 41 / 0.0001 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT5G42980 39 / 0.0005 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G092700 [exp] 316 / 7e-111 AT2G18990 290 / 2e-100 thioredoxin domain-containing protein 9 homolog (.1) Potri.007G020400 [exp] 117 / 3e-32 AT5G66410 297 / 8e-103 phosducin-like protein 3 homolog (.1) Potri.015G036000 [exp] 45 / 2e-05 AT3G17880 396 / 3e-137 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.017G076700 [exp] 42 / 6e-05 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Potri.005G232700 [exp] 40 / 0.0002 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.012G045000 [exp] 41 / 0.0004 AT3G17880 379 / 4e-131 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013889 [exp] 262 / 2e-90 AT3G25580 255 / 1e-87 Thioredoxin superfamily protein (.1) Lus10026602 [exp] 166 / 4e-53 AT3G25580 168 / 3e-54 Thioredoxin superfamily protein (.1) Lus10025176 [exp] 120 / 1e-33 AT5G66410 362 / 1e-128 phosducin-like protein 3 homolog (.1) Lus10016055 [exp] 119 / 5e-33 AT5G66410 357 / 2e-126 phosducin-like protein 3 homolog (.1) Lus10026999 [exp] 47 / 2e-06 AT3G02730 211 / 1e-70 thioredoxin F-type 1 (.1) Lus10020199 [exp] 47 / 2e-06 AT3G02730 207 / 6e-69 thioredoxin F-type 1 (.1) Lus10036695 [exp] 45 / 4e-06 AT5G39950 125 / 1e-37 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10037228 [exp] 44 / 1e-05 AT1G59730 128 / 6e-39 thioredoxin H-type 7 (.1) Lus10005258 [exp] 42 / 4e-05 AT5G39950 189 / 4e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10036696 [exp] 43 / 5e-05 AT1G59730 127 / 2e-38 thioredoxin H-type 7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF02114 [poplar] [flax] Phosducin Phosducin
Representative CDS sequence Show only first row Show all	>Potri.001G297900.1 pacid=42793161 polypeptide=Potri.001G297900.1.p locus=Potri.001G297900 ID=Potri.001G297900.1.v4.1 annot-version=v4.1 ATGGCAAACCCTAACCTCCAAGATATTATAGAGAAGCAAGTGCTTACTGTAGCCAAGGCAGTGGAAGACAAGATCGATGAAGAGATCGCAGCCTTAGACC GTCTCGATCTCGACGATATAGAAGCATTGAGAGAGAGACGGTTACAACAGATGAAGAAAATGGCGGAGAAGCGTAGTCGTTGGATCTCTTTAGGTCATGG TGAGTACACGGAGATTCCATCAGAGAAGGATTTCTTCTCTGTTGTTAAAGCTAGTGATCGTGTCGTTTGCCATTTCTATCGTGATAATTGGCCTTGCAAG GTGATGGACAAGCACATGAGCATACTGGCGAAGCAACATATAGAGACACGTTTTGTGAAGATCCATGCTGAGAAAAGTCCATTTTTGGCTGAAAAACTCA AGATTGTTGTTCTTCCAACTCTTGCACTTATAAAGAATACCAAAGTGGATGATTATGTGGTGGGATTTGATGAGCTGGGAGGGACAGATGAGTTTAACAC AGAGGATTTGGAGGAGAGATTGGCTAAAGCTCAAGTGATCTTTTTTGAGGGTGAATCGTCTCAAAATTCATCGAAATCCAGTGCACAAACCAGGAGTGTG CGACAAAGTGAGAGCCATGACTCTTCAGATTCAGATTAA
AA sequence Show only first row Show all	>Potri.001G297900.1 pacid=42793161 polypeptide=Potri.001G297900.1.p locus=Potri.001G297900 ID=Potri.001G297900.1.v4.1 annot-version=v4.1 MANPNLQDIIEKQVLTVAKAVEDKIDEEIAALDRLDLDDIEALRERRLQQMKKMAEKRSRWISLGHGEYTEIPSEKDFFSVVKASDRVVCHFYRDNWPCK VMDKHMSILAKQHIETRFVKIHAEKSPFLAEKLKIVVLPTLALIKNTKVDDYVVGFDELGGTDEFNTEDLEERLAKAQVIFFEGESSQNSSKSSAQTRSV RQSESHDSSDSD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G25580			Thioredoxin superfamily protei...		Potri.001G297900 [exp]	0	1
AT3G54650		FBL17	RNI-like superfamily protein (...		Potri.002G044800 [exp]	1.00	0.8606
AT3G07190			B-cell receptor-associated pro...		Potri.002G245300 [exp]	3.16	0.8476
AT4G18800		AthSGBP, AtRab1...	RAB GTPase homolog A1D (.1)		Potri.004G061000 [exp]	5.29	0.8157
AT3G19210		ATRAD54, CHR25	homolog of RAD54 (.1.2)		Potri.004G141500 [exp]	6.70	0.8507
AT4G12540			unknown protein		Potri.013G040800 [exp]	8.71	0.8563
AT1G06475			unknown protein		Potri.005G203800 [exp]	12.32	0.8043
AT1G67060			unknown protein		Potri.004G098800 [exp]	12.48	0.7553
AT5G42700	B3		AP2/B3-like transcriptional fa...		Potri.014G031600 [exp]	12.80	0.8480
AT4G30860		SDG4, ASHR3	ASH1-related 3, SET domain gro...		Potri.018G102100 [exp]	14.38	0.8309
AT1G71900			Protein of unknown function (D...		Potri.013G114100 [exp]	17.14	0.8412

Compare expression of checked genes

Potri.001G297900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.