Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19460 145 / 8e-44 Reticulon family protein (.1.2) AT2G15280 136 / 2e-40 Reticulon family protein (.1.2) AT3G10915 106 / 2e-28 Reticulon family protein (.1.2.3.4.5.6) AT1G64090 102 / 2e-26 RTNLB3 Reticulan like protein B3 (.1.2) AT4G23630 102 / 3e-26 RTNLB1, BTI1 Reticulan like protein B1, VIRB2-interacting protein 1 (.1) AT2G46170 96 / 3e-24 Reticulon family protein (.1.2) AT4G11220 96 / 5e-24 RTNLB2, BTI2 Reticulan like protein B2, VIRB2-interacting protein 2 (.1) AT3G10260 96 / 5e-24 Reticulon family protein (.1.2.3) AT5G41600 92 / 2e-22 RTNLB4, BTI3 Reticulan like protein B4, VIRB2-interacting protein 3 (.1) AT3G61560 84 / 2e-19 Reticulon family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G096200 [exp] 283 / 5e-98 AT2G15280 132 / 1e-38 Reticulon family protein (.1.2) Potri.019G057400 [exp] 115 / 8e-32 AT3G10915 260 / 6e-88 Reticulon family protein (.1.2.3.4.5.6) Potri.001G097700 [exp] 110 / 8e-30 AT4G23630 314 / 2e-108 Reticulan like protein B1, VIRB2-interacting protein 1 (.1) Potri.005G206800 [exp] 109 / 2e-29 AT3G10260 315 / 3e-109 Reticulon family protein (.1.2.3) Potri.003G133600 [exp] 108 / 5e-29 AT4G23630 284 / 8e-97 Reticulan like protein B1, VIRB2-interacting protein 1 (.1) Potri.014G091200 [exp] 106 / 3e-28 AT2G46170 318 / 3e-110 Reticulon family protein (.1.2) Potri.016G110200 [exp] 105 / 5e-28 AT3G54120 193 / 1e-62 Reticulon family protein (.1) Potri.015G027300 [exp] 105 / 7e-28 AT4G23630 310 / 6e-107 Reticulan like protein B1, VIRB2-interacting protein 1 (.1) Potri.002G165400 [exp] 103 / 3e-27 AT2G46170 311 / 1e-107 Reticulon family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014102 [exp] 187 / 6e-60 AT3G19460 209 / 5e-69 Reticulon family protein (.1.2) Lus10019812 [exp] 187 / 6e-60 AT3G19460 208 / 1e-68 Reticulon family protein (.1.2) Lus10002815 [exp] 162 / 2e-50 AT3G19460 188 / 1e-60 Reticulon family protein (.1.2) Lus10027867 [exp] 140 / 2e-41 AT3G19460 184 / 1e-58 Reticulon family protein (.1.2) Lus10032451 [exp] 108 / 3e-29 AT3G18260 268 / 9e-92 Reticulon family protein (.1) Lus10041080 [exp] 109 / 5e-29 AT2G46170 320 / 5e-111 Reticulon family protein (.1.2) Lus10036405 [exp] 107 / 2e-28 AT2G46170 320 / 8e-111 Reticulon family protein (.1.2) Lus10034224 [exp] 106 / 2e-28 AT3G10915 291 / 1e-100 Reticulon family protein (.1.2.3.4.5.6) Lus10029822 [exp] 94 / 2e-23 AT3G10260 330 / 2e-115 Reticulon family protein (.1.2.3) Lus10027548 [exp] 94 / 4e-23 AT1G64090 316 / 2e-109 Reticulan like protein B3 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0484 [poplar] [flax] Peroxisome PF02453 [poplar] [flax] Reticulon Reticulon
Representative CDS sequence Show only first row Show all	>Potri.001G300400.2 pacid=42791048 polypeptide=Potri.001G300400.2.p locus=Potri.001G300400 ID=Potri.001G300400.2.v4.1 annot-version=v4.1 ATGGGCGAGTCCGTCACCCCTCGTCGCATCTCCGTCCATCAAGCTCTTGGCGGCGGCCCAGTGGCTGATGTGTTGTTATGGAAGAGATGGTACGCAAGCG TTGGTGTTTTAGTGTCTGCAACAACTCTGTGGATCTTATTTGAGAAAGCTGGTTACAATTTGTTATCGTTTGTGGCTAACGTGTTGTTCCTTCTTGTTGT TATTCTCTTCTTTTGGGCTAAATCTGCTTCGCTTCTCAATCGGCCATTCCCTCCACTTCCAAATTTGGAAATTCCCGAGGAGATTGTTGCCAAGGCAGCT GGTATTATTCACGTGTATGCCAATTATGCATTGTCGATTGCGCGTGAAATCGTGATCGAGAAGAATTTCAAGGTTTTCCTCCAGGTTGTTTCTGGTTTCT GTGTAGCATCTTATATCGGTAGTCTCTGCAACTTCCTAACTCTTGTCTACATTGGGGTTCTTCTTAGTCTTTCAGTTCCTTTGGTATATGACAAGTACCA GCACCACATTGATGAAAAGATTTGTTTAGCCCATAAAATAATTCAAGAACAGTATAAGAAAATTCATGATGCCATCTTGAAGAAGATTCCATTATCATCA AACAAGGAAAAGAAAACACAGTAG
AA sequence Show only first row Show all	>Potri.001G300400.2 pacid=42791048 polypeptide=Potri.001G300400.2.p locus=Potri.001G300400 ID=Potri.001G300400.2.v4.1 annot-version=v4.1 MGESVTPRRISVHQALGGGPVADVLLWKRWYASVGVLVSATTLWILFEKAGYNLLSFVANVLFLLVVILFFWAKSASLLNRPFPPLPNLEIPEEIVAKAA GIIHVYANYALSIAREIVIEKNFKVFLQVVSGFCVASYIGSLCNFLTLVYIGVLLSLSVPLVYDKYQHHIDEKICLAHKIIQEQYKKIHDAILKKIPLSS NKEKKTQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G19460			Reticulon family protein (.1.2...		Potri.001G300400 [exp]	0	1
AT1G16300		GAPCP-2	glyceraldehyde-3-phosphate deh...		Potri.008G083900 [exp]	3.46	0.9379	GAPDH1.4
AT4G27080		ATPDI7, ATPDIL5...	ARABIDOPSIS THALIANA PROTEIN D...		Potri.011G135500 [exp]	5.65	0.9398
AT4G22840			Sodium Bile acid symporter fam...		Potri.003G117300 [exp]	8.12	0.9040
AT2G40730		CTEXP	cytoplasmic tRNA export protei...		Potri.013G090500 [exp]	8.66	0.9268
AT1G14020			O-fucosyltransferase family pr...		Potri.008G090600 [exp]	9.16	0.9342
AT2G25737			Sulfite exporter TauE/SafE fam...		Potri.018G037500 [exp]	10.58	0.9271
AT2G22260			oxidoreductase, 2OG-Fe(II) oxy...		Potri.006G004500 [exp]	11.61	0.9122
AT1G80510			Transmembrane amino acid trans...		Potri.001G204400 [exp]	13.56	0.8883
AT1G10950		AtTMN1	transmembrane nine 1 (.1)		Potri.004G218300 [exp]	18.81	0.9245
AT5G12260			unknown protein		Potri.001G272400 [exp]	19.36	0.9080

Compare expression of checked genes

Potri.001G300400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.