Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RPS16.3
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G09990 268 / 7e-94 Ribosomal protein S5 domain 2-like superfamily protein (.1) AT5G18380 267 / 1e-93 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3) AT3G04230 257 / 1e-89 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G150000 [exp] 286 / 2e-101 AT2G09990 262 / 1e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1) Potri.010G091000 [exp] 284 / 3e-100 AT2G09990 260 / 7e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012599 [exp] 277 / 2e-97 AT5G18380 261 / 4e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3) Lus10034378 [exp] 277 / 2e-97 AT5G18380 261 / 4e-91 Ribosomal protein S5 domain 2-like superfamily protein (.1.2.3) Lus10035133 [exp] 274 / 3e-96 AT2G09990 258 / 4e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1) Lus10031970 [exp] 274 / 3e-96 AT2G09990 258 / 4e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1) Lus10038012 [exp] 274 / 4e-96 AT2G09990 258 / 5e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1) Lus10009252 [exp] 274 / 4e-96 AT2G09990 258 / 5e-90 Ribosomal protein S5 domain 2-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0329 [poplar] [flax] S5 PF00380 [poplar] [flax] Ribosomal_S9 Ribosomal protein S9/S16
Representative CDS sequence Show only first row Show all	>Potri.001G304700.1 pacid=42789038 polypeptide=Potri.001G304700.1.p locus=Potri.001G304700 ID=Potri.001G304700.1.v4.1 annot-version=v4.1 ATGGCGACAGCTGCACCAACAGAGTCGGTTCAATGTTTCGGGCGGAAGAAAACGGCAGTAGCAGTCACCCACTGCAAGCGCGGCCGCGGCCTAATCAAAA TCAACGGCAGCCCAATTGAACTCGTTGAACCGGAGATCCTCCGATTCAAGGCTTACGAGCCAATCCTCCTCCTTGGACGACATCGATTTGCTGGTGTCGA CATGAGGATCAGAGTAAAGGGTGGAGGTCATACCTCGCAGATTTACGCGATAAGGCAGAGCATAGCGAAGGCTCTTGTTGCTTTCTATCAAAAGTATGTT GATGAGCAAAGCAAGAAGGAGATTAAAGATATACTGGTTAGGTACGATAGGACTTTGCTTGTAGCGGATCCAAGAAGGTGCGAGACTAAGAAGTTTGGTG GACGTGGTGCCCGTGCTAGGTTCCAGAAGAGTTACCGTTGA
AA sequence Show only first row Show all	>Potri.001G304700.1 pacid=42789038 polypeptide=Potri.001G304700.1.p locus=Potri.001G304700 ID=Potri.001G304700.1.v4.1 annot-version=v4.1 MATAAPTESVQCFGRKKTAVAVTHCKRGRGLIKINGSPIELVEPEILRFKAYEPILLLGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYV DEQSKKEIKDILVRYDRTLLVADPRRCETKKFGGRGARARFQKSYR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G09990			Ribosomal protein S5 domain 2-...		Potri.001G304700 [exp]	0	1	RPS16.3
AT5G64140		RPS28	ribosomal protein S28 (.1)		Potri.016G063100 [exp]	2.00	0.9706
AT2G09990			Ribosomal protein S5 domain 2-...		Potri.008G150000 [exp]	2.44	0.9758
AT1G70600			Ribosomal protein L18e/L15 sup...		Potri.008G187000 [exp]	3.00	0.9744
AT2G37190			Ribosomal protein L11 family p...		Potri.018G145504 [exp]	3.00	0.9632
AT1G67430			Ribosomal protein L22p/L17e fa...		Potri.015G094400 [exp]	3.16	0.9762	RPL17.2
AT2G37270		ATRPS5B	ribosomal protein 5B (.1.2)		Potri.016G063200 [exp]	5.29	0.9614	Pt-RPS5.1
AT4G36130			Ribosomal protein L2 family (....		Potri.005G115700 [exp]	6.32	0.9662	RPL2.2
AT3G02560			Ribosomal protein S7e family p...		Potri.016G100400 [exp]	7.00	0.9668
AT4G16720			Ribosomal protein L23/L15e fam...		Potri.001G156100 [exp]	7.07	0.9701	RPL15.3
AT4G18100			Ribosomal protein L32e (.1)		Potri.002G249000 [exp]	8.12	0.9582

Compare expression of checked genes

Potri.001G304700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.