Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53590 75 / 2e-18 SAUR-like auxin-responsive protein family (.1) AT4G00880 67 / 2e-15 SAUR-like auxin-responsive protein family (.1) AT2G46690 66 / 4e-15 SAUR-like auxin-responsive protein family (.1) AT3G61900 66 / 6e-15 SAUR-like auxin-responsive protein family (.1) AT4G22620 66 / 2e-14 SAUR-like auxin-responsive protein family (.1) AT3G43120 65 / 2e-14 SAUR-like auxin-responsive protein family (.1) AT5G20810 65 / 2e-14 SAUR-like auxin-responsive protein family (.1.2) AT4G34800 63 / 3e-14 SAUR-like auxin-responsive protein family (.1) AT3G60690 63 / 2e-13 SAUR-like auxin-responsive protein family (.1) AT4G12410 62 / 2e-13 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G002201 [exp] 157 / 3e-51 AT5G53590 74 / 8e-18 SAUR-like auxin-responsive protein family (.1) Potri.002G176400 [exp] 71 / 5e-17 AT2G46690 145 / 2e-46 SAUR-like auxin-responsive protein family (.1) Potri.012G023400 [exp] 71 / 6e-17 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1) Potri.014G103300 [exp] 68 / 6e-16 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1) Potri.015G006800 [exp] 66 / 6e-15 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 63 / 4e-14 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G165300 [exp] 62 / 6e-14 AT4G38840 130 / 6e-41 SAUR-like auxin-responsive protein family (.1) Potri.006G137200 [exp] 64 / 1e-13 AT5G20810 201 / 1e-66 SAUR-like auxin-responsive protein family (.1.2) Potri.014G066900 [exp] 63 / 1e-13 AT3G60690 191 / 9e-63 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005781 [exp] 119 / 6e-36 AT5G53590 70 / 8e-16 SAUR-like auxin-responsive protein family (.1) Lus10006820 [exp] 116 / 5e-35 AT5G53590 69 / 5e-16 SAUR-like auxin-responsive protein family (.1) Lus10010110 [exp] 66 / 8e-15 AT2G46690 124 / 1e-37 SAUR-like auxin-responsive protein family (.1) Lus10007561 [exp] 61 / 3e-13 AT4G34810 125 / 1e-38 SAUR-like auxin-responsive protein family (.1) Lus10034888 [exp] 62 / 4e-13 AT5G20810 210 / 2e-70 SAUR-like auxin-responsive protein family (.1.2) Lus10032949 [exp] 61 / 6e-13 AT4G00880 104 / 9e-30 SAUR-like auxin-responsive protein family (.1) Lus10012184 [exp] 60 / 1e-12 AT4G34810 125 / 9e-39 SAUR-like auxin-responsive protein family (.1) Lus10008845 [exp] 59 / 3e-12 AT2G46690 102 / 4e-29 SAUR-like auxin-responsive protein family (.1) Lus10035716 [exp] 60 / 4e-12 AT2G24400 157 / 9e-49 SAUR-like auxin-responsive protein family (.1) Lus10010713 [exp] 58 / 4e-12 AT4G38840 111 / 2e-33 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.001G306300.1 pacid=42791929 polypeptide=Potri.001G306300.1.p locus=Potri.001G306300 ID=Potri.001G306300.1.v4.1 annot-version=v4.1 ATGAGCAACATGCAGGAAGACAAGAAATCGAAGGTAAAGAAAGGATGGCTTGCAGTTCGAGTTGGTTTAGAGGATGAAGATTGTGGGTTTCAAAGATTTG TAATCCCGATTTCATACCTTTATCACCCTCTTTTCAAGCGACTTTTAGAAAAAGCTCATGAAGTTTATGGCTACCACACAACAGGTCCACTAAGGGTACC GTGTTCTGTTGATGATTTTCTTCATCTCCGGTGGAGGATTGAAAAGGAGTCCAGTCATCATAGCCATCACAGCCACCATCAGCACCACCTTCCTAGTTCT CTGTCTTTTTACTCTTGCTGA
AA sequence Show only first row Show all	>Potri.001G306300.1 pacid=42791929 polypeptide=Potri.001G306300.1.p locus=Potri.001G306300 ID=Potri.001G306300.1.v4.1 annot-version=v4.1 MSNMQEDKKSKVKKGWLAVRVGLEDEDCGFQRFVIPISYLYHPLFKRLLEKAHEVYGYHTTGPLRVPCSVDDFLHLRWRIEKESSHHSHHSHHQHHLPSS LSFYSC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G53590			SAUR-like auxin-responsive pro...		Potri.001G306300 [exp]	0	1
AT4G23140		RLK5, CRK6	cysteine-rich RLK (RECEPTOR-li...		Potri.004G028400 [exp]	3.46	0.9441
AT2G42975			unknown protein		Potri.002G058000 [exp]	6.16	0.9488
AT4G23140		RLK5, CRK6	cysteine-rich RLK (RECEPTOR-li...		Potri.004G028532 [exp]	10.95	0.9279
					Potri.005G063600 [exp]	16.70	0.9387
AT1G53035			unknown protein		Potri.004G044000 [exp]	18.33	0.8910
AT2G46735			unknown protein		Potri.002G178100 [exp]	18.54	0.9372
AT4G08570			Heavy metal transport/detoxifi...		Potri.005G003700 [exp]	18.70	0.9265
AT1G60470		ATGOLS4	galactinol synthase 4 (.1)		Potri.008G189400 [exp]	19.33	0.9242
AT4G01940		ATCNFU1, NFU1	NFU domain protein 1 (.1)		Potri.014G117700 [exp]	21.63	0.9295
					Potri.018G137700 [exp]	25.09	0.9265

Compare expression of checked genes

Potri.001G306300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.