Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G76750 113 / 3e-33 Protein of unknown function (DUF1278) (.1) AT2G21750 91 / 1e-24 Protein of unknown function (DUF1278) (.1) AT2G21740 88 / 8e-24 Protein of unknown function (DUF1278) (.1) AT4G39340 88 / 2e-23 Protein of unknown function (DUF1278) (.1) AT5G64720 58 / 1e-11 Protein of unknown function (DUF1278) (.1) AT4G35165 38 / 0.0003 Protein of unknown function (DUF1278) (.1) AT3G48675 36 / 0.0009 Protein of unknown function (DUF1278) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G191800 [exp] 110 / 2e-32 AT1G76750 115 / 7e-34 Protein of unknown function (DUF1278) (.1) Potri.001G353600 [exp] 108 / 1e-31 AT1G76750 120 / 1e-35 Protein of unknown function (DUF1278) (.1) Potri.009G077000 [exp] 106 / 2e-30 AT1G76750 127 / 6e-38 Protein of unknown function (DUF1278) (.1) Potri.001G306600 [exp] 97 / 5e-27 AT2G21740 112 / 7e-33 Protein of unknown function (DUF1278) (.1) Potri.011G078401 [exp] 49 / 2e-08 AT1G76750 54 / 3e-10 Protein of unknown function (DUF1278) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004598 [exp] 108 / 4e-31 AT1G76750 131 / 2e-39 Protein of unknown function (DUF1278) (.1) Lus10004548 [exp] 103 / 4e-29 AT1G76750 130 / 4e-39 Protein of unknown function (DUF1278) (.1) Lus10027057 [exp] 45 / 7e-07 AT1G76750 50 / 4e-08 Protein of unknown function (DUF1278) (.1) Lus10025591 [exp] 45 / 1e-06 AT1G76750 48 / 6e-08 Protein of unknown function (DUF1278) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF05617 [poplar] [flax] Prolamin_like Prolamin-like
Representative CDS sequence Show only first row Show all	>Potri.001G306700.2 pacid=42788183 polypeptide=Potri.001G306700.2.p locus=Potri.001G306700 ID=Potri.001G306700.2.v4.1 annot-version=v4.1 ATGGCGGCACACCCTCAAGTCTCCACCCACACAACTCTCGCTACCCGTCTCCGGTTAGACAACGAAGAAACGACCTGCTGGGGCTCCTTACTCCACCTCC AATCCTGCATCTCCAATGTCCTTCTCTTCTTCCTTAACGGCGAGACTTATCTCCGCCCTAGCTGCTGCCACGCCATCCGCATCATCGGACACCATTGCTG GCCTTCCATGCTTGCCTCCCTTGGTTTCACCGTTCAAGAAGGTGATATCCTGCGCGGCTACTGCGATGCCACTGCTCATTCATCTTCTCCACCACCAGAA CCCATTTTTTTTCCCAACCACACTTGA
AA sequence Show only first row Show all	>Potri.001G306700.2 pacid=42788183 polypeptide=Potri.001G306700.2.p locus=Potri.001G306700 ID=Potri.001G306700.2.v4.1 annot-version=v4.1 MAAHPQVSTHTTLATRLRLDNEETTCWGSLLHLQSCISNVLLFFLNGETYLRPSCCHAIRIIGHHCWPSMLASLGFTVQEGDILRGYCDATAHSSSPPPE PIFFPNHT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G76750			Protein of unknown function (D...		Potri.001G306700 [exp]	0	1
AT3G02280			Flavodoxin family protein (.1)		Potri.011G027100 [exp]	4.47	0.7691
					Potri.009G014750 [exp]	5.74	0.8031
AT1G74150			Galactose oxidase/kelch repeat...		Potri.013G008200 [exp]	12.96	0.7303
AT3G07870			F-box and associated interacti...		Potri.010G207401 [exp]	14.28	0.6382
					Potri.004G103350 [exp]	16.49	0.7125
					Potri.017G037400 [exp]	18.97	0.7038
					Potri.005G192050 [exp]	19.89	0.7266
AT1G45616		AtRLP6	receptor like protein 6 (.1)		Potri.001G128400 [exp]	23.36	0.6603
AT4G25040			Uncharacterised protein family...		Potri.015G103600 [exp]	23.95	0.7168
AT2G32440		ATKAO2, CYP88A4...	ARABIDOPSIS ENT-KAURENOIC ACID...		Potri.001G144933 [exp]	24.39	0.7307

Compare expression of checked genes

Potri.001G306700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.