Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G09830 132 / 7e-42 BolA-like family protein (.1) AT4G26500 49 / 5e-08 SUFE1, EMB1374, CPSUFE, ATSUFE SULFUR E 1, MBRYO DEFECTIVE 1374, ARABIDOPSIS THALIANA SULFUR E, chloroplast sulfur E (.1) AT1G55805 40 / 6e-05 BolA-like family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G036800 [exp] 44 / 8e-07 AT1G55805 130 / 6e-40 BolA-like family protein (.1) Potri.001G468300 [exp] 45 / 1e-06 AT4G26500 392 / 5e-136 SULFUR E 1, MBRYO DEFECTIVE 1374, ARABIDOPSIS THALIANA SULFUR E, chloroplast sulfur E (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020861 [exp] 148 / 4e-48 AT5G09830 138 / 4e-44 BolA-like family protein (.1) Lus10015605 [exp] 52 / 5e-09 AT4G26500 387 / 2e-133 SULFUR E 1, MBRYO DEFECTIVE 1374, ARABIDOPSIS THALIANA SULFUR E, chloroplast sulfur E (.1) Lus10032905 [exp] 50 / 2e-08 AT4G26500 380 / 4e-131 SULFUR E 1, MBRYO DEFECTIVE 1374, ARABIDOPSIS THALIANA SULFUR E, chloroplast sulfur E (.1) Lus10026101 [exp] 44 / 6e-07 AT4G26500 124 / 1e-37 SULFUR E 1, MBRYO DEFECTIVE 1374, ARABIDOPSIS THALIANA SULFUR E, chloroplast sulfur E (.1) Lus10002318 [exp] 43 / 2e-06 AT1G55805 119 / 2e-35 BolA-like family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01722 [poplar] [flax] BolA BolA-like protein
Representative CDS sequence Show only first row Show all	>Potri.001G309200.1 pacid=42790812 polypeptide=Potri.001G309200.1.p locus=Potri.001G309200 ID=Potri.001G309200.1.v4.1 annot-version=v4.1 ATGGGAGTTACAAAGGAACTAGTTGAGTCTACTCTAAAGTCAAAATTGAATCCTTCACATCTTGAAGTGGTTGATACATCTGGAGGCTGTGGTGCAAGTT TTGCTATTGAGATTGTCTCAGAACAATTTGAGGGGAAGAGGCTGCTGGAGAGGCATCGACTTGTCAATGCTGCTCTGGTAGAGGAGATGAAAGAGATCCA TGCCCTCTCAATAAAGAAAGCTGTGACCCCTGCGCAGTGGAAACAACAGCAAGAGACCCAGCAATCTACATCTGCTGCATAA
AA sequence Show only first row Show all	>Potri.001G309200.1 pacid=42790812 polypeptide=Potri.001G309200.1.p locus=Potri.001G309200 ID=Potri.001G309200.1.v4.1 annot-version=v4.1 MGVTKELVESTLKSKLNPSHLEVVDTSGGCGASFAIEIVSEQFEGKRLLERHRLVNAALVEEMKEIHALSIKKAVTPAQWKQQQETQQSTSAA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G09830			BolA-like family protein (.1)		Potri.001G309200 [exp]	0	1
AT3G21750		UGT71B1	UDP-glucosyl transferase 71B1 ...		Potri.016G016900 [exp]	2.00	0.9521
AT1G50020			unknown protein		Potri.009G084800 [exp]	6.00	0.9460
AT1G49620		ICN6, ICK5, KRP...	KIP-RELATED PROTEIN 7, Cyclin-...		Potri.009G103600 [exp]	8.36	0.9439	Pt-ICK5.1,7
AT1G63970		MECPS, ISPF	2C-METHYL-D-ERYTHRITOL 2,4-CYC...		Potri.003G132400 [exp]	10.39	0.9468
AT5G49940		ATCNFU2, NFU2	CHLOROPLAST-LOCALIZED NIFU-LIK...		Potri.003G009300 [exp]	12.00	0.9365
AT2G45990			unknown protein		Potri.014G086100 [exp]	13.03	0.9259
AT3G27750		EMB3123	EMBRYO DEFECTIVE 3123, unknown...		Potri.003G051400 [exp]	17.77	0.9457
AT5G19855		AtRbcX2	homologue of cyanobacterial Rb...		Potri.001G258100 [exp]	18.02	0.9354
AT4G04950		AtGRXS17	Arabidopsis thaliana monothiol...		Potri.011G051400 [exp]	18.49	0.9223
AT1G07650			Leucine-rich repeat transmembr...		Potri.004G063900 [exp]	20.32	0.9409

Compare expression of checked genes

Potri.001G309200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.