Potri.001G309900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17860 90 / 2e-22 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73325 73 / 6e-16 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73260 69 / 3e-14 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
AT3G04320 47 / 2e-06 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73330 45 / 1e-05 ATDR4 drought-repressed 4 (.1)
AT3G04330 43 / 3e-05 Kunitz family trypsin and protease inhibitor protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G006900 211 / 7e-70 AT1G73260 79 / 6e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.004G000400 202 / 2e-66 AT1G73260 91 / 9e-23 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.007G111600 201 / 5e-66 AT1G73260 70 / 8e-15 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.007G111800 198 / 8e-65 AT1G73260 79 / 3e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.007G111500 195 / 1e-63 AT1G73260 79 / 5e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.007G111700 190 / 1e-61 AT1G73260 70 / 1e-14 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.004G067900 98 / 2e-25 AT1G17860 183 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153200 95 / 3e-24 AT1G17860 191 / 5e-62 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153400 89 / 3e-22 AT1G17860 223 / 1e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029429 196 / 6e-64 AT1G73260 77 / 4e-17 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Lus10004223 190 / 2e-61 AT1G73260 81 / 1e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Lus10039210 92 / 3e-23 AT1G17860 179 / 4e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007889 91 / 1e-22 AT1G17860 163 / 1e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013770 91 / 2e-22 AT1G17860 166 / 6e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039163 91 / 2e-22 AT1G17860 167 / 4e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013730 90 / 3e-22 AT1G17860 175 / 2e-55 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039209 88 / 1e-21 AT1G17860 179 / 6e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007890 88 / 2e-21 AT1G17860 166 / 7e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10030354 88 / 2e-21 AT1G17860 160 / 1e-49 Kunitz family trypsin and protease inhibitor protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0066 Trefoil PF00197 Kunitz_legume Trypsin and protease inhibitor
Representative CDS sequence
>Potri.001G309900.1 pacid=42787969 polypeptide=Potri.001G309900.1.p locus=Potri.001G309900 ID=Potri.001G309900.1.v4.1 annot-version=v4.1
ATGTTGAAATTGATTGGAAGCTTGAGTTGCATATGGCTACTCATGGCCATATCTACCATGGCTCAAGACCAGCCTCCTGTGCTTGACACCGCCGGACGAC
CTGTAAGAAGTGGCGTAGAATACTACATCCTGCCAGCTGCAACCGATATTGCTGGTGGGTTAACACTAGTGGCTCGCAATGGATCCTGCCCATCTTTCGT
TGGTCAAGAACCCCTCACACCAGTTGTATCACAGGGCCTTCCTGTTGTCTTCTCACCGTATGTTGCTGGAGAGACCATTGTTAGGGAATCCCGTAGCTTC
ATAATTGAGTTCTCAGCTGCCTCAACTTGTGTCAGCTCTACTAAATGGAACTTAGCTGCAAGAGATCCAGCAACGTCAAGGAGAAATATTGGGATAGGAA
GAAGTGGAAGTTATTTCATGATTACTAAGGAGAACAATCTCTATTACTTGGCATTTTGTCCAGCTGATACTTGCAACACCTGTAGGTTTGATTGTGGGAC
TGCTGGCATCACGATAGAGAATGGCAAGAGGTTTTTGACATTGGATGGTCCTGTATTTCCTTTTAGATTCAGGAGGGCTTAA
AA sequence
>Potri.001G309900.1 pacid=42787969 polypeptide=Potri.001G309900.1.p locus=Potri.001G309900 ID=Potri.001G309900.1.v4.1 annot-version=v4.1
MLKLIGSLSCIWLLMAISTMAQDQPPVLDTAGRPVRSGVEYYILPAATDIAGGLTLVARNGSCPSFVGQEPLTPVVSQGLPVVFSPYVAGETIVRESRSF
IIEFSAASTCVSSTKWNLAARDPATSRRNIGIGRSGSYFMITKENNLYYLAFCPADTCNTCRFDCGTAGITIENGKRFLTLDGPVFPFRFRRA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G17860 Kunitz family trypsin and prot... Potri.001G309900 0 1
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.008G213100 3.46 0.9873
AT3G12490 ATCYS6, ATCYSB ARABIDOPSIS THALIANA PHYTOCYST... Potri.001G225800 7.87 0.9881
AT1G73260 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TR... Potri.007G111600 10.19 0.9802
AT2G23620 ATMES1 ARABIDOPSIS THALIANA METHYL ES... Potri.007G037033 10.44 0.9890
AT3G04120 GAPC1, GAPC-1, ... glyceraldehyde-3-phosphate deh... Potri.008G179300 12.60 0.9801 GAPDH.1
Potri.001G194100 14.83 0.9842
AT5G36160 Tyrosine transaminase family p... Potri.007G138052 16.94 0.9373
AT4G14746 unknown protein Potri.013G039300 18.81 0.9877 Pt-MTN26.2
AT5G03610 GDSL-like Lipase/Acylhydrolase... Potri.010G236800 20.00 0.9602
AT1G27100 Actin cross-linking protein (.... Potri.017G075900 20.88 0.9876

Potri.001G309900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.