Potri.001G310200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G01020 80 / 4e-19 helicase domain-containing protein / IBR domain-containing protein / zinc finger protein-related (.1)
AT5G10370 75 / 3e-17 helicase domain-containing protein / IBR domain-containing protein / zinc finger protein-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G050100 136 / 6e-39 AT4G01020 1719 / 0.0 helicase domain-containing protein / IBR domain-containing protein / zinc finger protein-related (.1)
Potri.005G071500 81 / 2e-19 AT5G10370 1979 / 0.0 helicase domain-containing protein / IBR domain-containing protein / zinc finger protein-related (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012749 78 / 2e-18 AT5G10370 208 / 1e-15 helicase domain-containing protein / IBR domain-containing protein / zinc finger protein-related (.1)
Lus10023162 72 / 3e-16 AT5G10370 1876 / 0.0 helicase domain-containing protein / IBR domain-containing protein / zinc finger protein-related (.1)
PFAM info
Representative CDS sequence
>Potri.001G310200.3 pacid=42792511 polypeptide=Potri.001G310200.3.p locus=Potri.001G310200 ID=Potri.001G310200.3.v4.1 annot-version=v4.1
ATGAATGGAAAGACAGTAAATCATGGTAGCCTAACCCCAATTGTTCTGCAGCTTCTTTCCTCCAGAGATGGCATCATGCTCATGAAGTCAGTGCAGCAAC
AAATGGGAACTTGCATTCTATTTGATAGGCAGAACCTCACCATCAGGATCTTTGGCCCAGAGAACCAAGCTGCCCTTACGGAACAGAAGTTAGTAGCATC
TCTTCTAGCATTCCGTGATAAGCAGCAAACAGATATCCGTCTTTGA
AA sequence
>Potri.001G310200.3 pacid=42792511 polypeptide=Potri.001G310200.3.p locus=Potri.001G310200 ID=Potri.001G310200.3.v4.1 annot-version=v4.1
MNGKTVNHGSLTPIVLQLLSSRDGIMLMKSVQQQMGTCILFDRQNLTIRIFGPENQAALTEQKLVASLLAFRDKQQTDIRL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G01020 helicase domain-containing pro... Potri.001G310200 0 1
AT5G53940 Yippee family putative zinc-bi... Potri.011G115700 33.16 0.6642
AT2G01060 GARP myb-like HTH transcriptional r... Potri.006G000800 37.81 0.6723
AT4G36550 ARM repeat superfamily protein... Potri.005G122100 53.36 0.6686
AT1G54390 ING2 INHIBITOR OF GROWTH 2, PHD fin... Potri.019G033800 100.87 0.6092
AT4G18905 Transducin/WD40 repeat-like su... Potri.007G019601 101.33 0.6161
AT1G65660 SMP1 SWELLMAP 1, Pre-mRNA splicing ... Potri.012G064100 106.56 0.6527
AT5G51050 APC2 ATP/phosphate carrier 2, Mitoc... Potri.015G108900 131.15 0.6109
Potri.018G024000 209.42 0.6075
AT3G63220 Galactose oxidase/kelch repeat... Potri.005G211700 240.93 0.6020

Potri.001G310200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.