Plant FIBer expression Database

Potri.001G310400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G050300
[exp]
39 / 0.0003 AT5G64310 / arabinogalactan protein 1 (.1)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.001G310400.1 pacid=42788008 polypeptide=Potri.001G310400.1.p locus=Potri.001G310400 ID=Potri.001G310400.1.v4.1 annot-version=v4.1
ATGGCTGCAAACAAAAGCATGGTGTTCTTGATGCTAATCACATTCCTTGTGGCTTCCACAAAGGCACAATATTCTCCTTCATCTTCCCCTGCATCCTCAC
CCACCAAATCACCACCAGTCGCTACCCCACCACCAAAAGCCTCTGCTCCTGCACCCACCACCGTGAAACCACCGGCATCTGCACCATCTCCATTGGAAAC
CCCACCACCGGCAGCAAATGCACCATCCCCCACCACTACCACTTCTCCTCCTTCTCCTCTTCCAGTGACTCCAGTTCCCTCAACTGGAGATGTCCCTACT
TCTACAATCGGCTCTCCAGCTGTAGCCCCCGCTCCTGCCAACGGTGCCGTTTTGAATAGATTTGCTCTCGGTGGATCCGTTGCCGTTGGTGTTTTGGCTG
CCGTTTTGGTGCTTTGA
AA sequence
>Potri.001G310400.1 pacid=42788008 polypeptide=Potri.001G310400.1.p locus=Potri.001G310400 ID=Potri.001G310400.1.v4.1 annot-version=v4.1
MAANKSMVFLMLITFLVASTKAQYSPSSSPASSPTKSPPVATPPPKASAPAPTTVKPPASAPSPLETPPPAANAPSPTTTTSPPSPLPVTPVPSTGDVPT
STIGSPAVAPAPANGAVLNRFALGGSVAVGVLAAVLVL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G64310 ATAGP1, AGP1 arabinogalactan protein 1 (.1) Potri.001G310400
[exp]
0 1
AT4G16120 ATSEB1, COBL7 ARABIDOPSIS THALIANA SEC61 BET... Potri.010G001100
[exp]
2.00 0.8790 ATSEB1.1
AT2G27080 Late embryogenesis abundant (L... Potri.004G197600
[exp]
2.82 0.8824
AT3G24480 Leucine-rich repeat (LRR) fami... Potri.018G075900
[exp]
3.16 0.8153
AT3G23750 Leucine-rich repeat protein ki... Potri.006G073900
[exp]
5.19 0.7986 RHG4.2
AT1G45688 unknown protein Potri.014G026800
[exp]
5.65 0.8293
AT5G54380 THE1 THESEUS1, protein kinase famil... Potri.011G128000
[exp]
6.00 0.8126
AT5G42340 PUB15 Plant U-Box 15 (.1) Potri.009G165900
[exp]
6.32 0.7956
AT2G25280 unknown protein Potri.006G258200
[exp]
7.74 0.7534
AT5G64310 ATAGP1, AGP1 arabinogalactan protein 1 (.1) Potri.017G050300
[exp]
7.93 0.8355
AT5G20950 Glycosyl hydrolase family prot... Potri.013G055600
[exp]
8.30 0.7420

Potri.001G310400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.