Potri.001G311000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G10360 421 / 3e-151 RPS6B, EMB3010 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2)
AT4G31700 397 / 9e-142 RPS6A, RPS6 ribosomal protein S6 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G096300 452 / 2e-163 AT5G10360 417 / 2e-149 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2)
Potri.005G072700 447 / 1e-161 AT5G10360 416 / 2e-149 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2)
Potri.005G162600 447 / 1e-161 AT5G10360 419 / 1e-150 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2)
Potri.002G099500 444 / 2e-160 AT5G10360 413 / 6e-148 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027260 431 / 4e-155 AT5G10360 448 / 8e-162 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2)
Lus10031021 431 / 7e-155 AT5G10360 448 / 4e-162 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2)
Lus10007376 428 / 6e-154 AT5G10360 451 / 3e-163 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2)
Lus10035414 427 / 8e-153 AT5G10360 446 / 5e-160 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2)
Lus10020794 431 / 3e-146 AT5G10360 449 / 8e-153 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01092 Ribosomal_S6e Ribosomal protein S6e
Representative CDS sequence
>Potri.001G311000.1 pacid=42793585 polypeptide=Potri.001G311000.1.p locus=Potri.001G311000 ID=Potri.001G311000.1.v4.1 annot-version=v4.1
ATGAAGTTTAACATTGCAAATCCAACAACTGGGTGCCAAAAGAAGCTTGAGATCGATGATGATCAGAAGCTGCGAGCTTTTTTTGACAAGAGGATCTCAC
AGGAGGTCAGTGGAGATTCCCTTGGTGAGGAGTTCAATGGATATGTGTTCAAAATCATGGGAGGCTGTGACAAGCAAGGATTTCCAATGAAGCAGGGAGT
TCTGACTCCTGGTCGTGTTCGTTTGTTGCTTCACAGAGGCACCCCTTGCTTCCGTGGATATGGAAGGCGCAATGGAGAACGCAGGAGAAAGTCTGTTCGT
GGATGCATTGTTAGTCAAGACCTCTCTGTTCTGAACTTGGTTATTGTGAAGAAGGGTGATAATGATCTACCTGGTTTGACTGACACTGAGAAACCCAGGA
TGAGGGGTCCAAAGAGGGCATCCAAAATCAGGAAGCTTTTTAACCTCTCTAAGGAGGATGATGTTCGCAAATATGTGAACACATACCGCAGGACCTTCAC
AACAAAATCTGGGAAGAAAGTCAGTAAAGCTCCAAAGATACAAAGGCTTGTAACTCCATTGACTCTCCAAAGGAAGCGAGCCAGGATTTCAGACAAAAAG
AAGAGAATTGCAAAGGCCAAGTCAGAAGCAGCTGAGTACCAGAAACTGCTTGCTACTCGGTTGAAGGAGCAGCGTGAGCGCCGTAGTGAGAGCTTAGCAA
AAAAGAGATCCAGGCTCTCAATTGCTTCCAAGCCATCTGTTGCTGCATAG
AA sequence
>Potri.001G311000.1 pacid=42793585 polypeptide=Potri.001G311000.1.p locus=Potri.001G311000 ID=Potri.001G311000.1.v4.1 annot-version=v4.1
MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDSLGEEFNGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVR
GCIVSQDLSVLNLVIVKKGDNDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTLQRKRARISDKK
KRIAKAKSEAAEYQKLLATRLKEQRERRSESLAKKRSRLSIASKPSVAA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G10360 RPS6B, EMB3010 Ribosomal protein small subuni... Potri.001G311000 0 1
AT1G67430 Ribosomal protein L22p/L17e fa... Potri.010G060400 2.64 0.8893
AT5G39740 OLI7, RPL5B OLIGOCELLULA 7, ribosomal prot... Potri.013G128600 2.82 0.8864
AT4G00100 PFL2, ATRPS13A POINTED FIRST LEAF 2, ribosoma... Potri.015G130000 6.48 0.8825 RPS13.4
AT5G02960 Ribosomal protein S12/S23 fami... Potri.010G217100 7.07 0.8459 RPS23.2
AT1G26880 Ribosomal protein L34e superfa... Potri.012G108400 8.36 0.8722 RPL34.4
AT2G47110 UBQ6 ubiquitin 6 (.1.2) Potri.002G190000 11.74 0.8662
AT2G18110 Translation elongation factor... Potri.009G018600 12.00 0.7930
AT5G49510 PFD3, PDF3 prefoldin 3 (.1.2) Potri.008G103400 12.00 0.7780
AT5G10360 RPS6B, EMB3010 Ribosomal protein small subuni... Potri.005G162600 12.64 0.8345
AT4G33865 Ribosomal protein S14p/S29e fa... Potri.001G295902 13.03 0.8339

Potri.001G311000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.