Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G65260 238 / 3e-80 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G10350 235 / 6e-79 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) AT5G51120 212 / 6e-70 PABN1, ATPABN1 polyadenylate-binding protein 1 (.1.2.3) AT3G12640 61 / 1e-10 RNA binding (RRM/RBD/RNP motifs) family protein (.1) AT2G36660 55 / 6e-09 PAB7 poly(A) binding protein 7 (.1) AT3G18610 54 / 2e-08 ATNUC-L2, PARLL1, ATRANGAP1 PARALLEL1-LIKE 1, nucleolin like 2 (.1) AT3G55460 51 / 8e-08 SCL30, At-SCL30 SC35-like splicing factor 30 (.1) AT2G23350 49 / 1e-06 PABP4, PAB4 poly(A) binding protein 4 (.1) AT2G35410 48 / 1e-06 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT2G16940 48 / 1e-06 Splicing factor, CC1-like (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G051600 [exp] 341 / 3e-121 AT5G65260 288 / 4e-100 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.005G073200 [exp] 260 / 6e-89 AT5G10350 292 / 2e-101 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Potri.007G095800 [exp] 249 / 2e-84 AT5G10350 285 / 3e-98 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Potri.012G115100 [exp] 233 / 6e-78 AT5G65260 271 / 5e-93 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.015G110800 [exp] 231 / 2e-77 AT5G51120 266 / 1e-90 polyadenylate-binding protein 1 (.1.2.3) Potri.012G145050 [exp] 65 / 6e-13 AT2G24350 107 / 4e-27 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Potri.009G063800 [exp] 67 / 8e-13 AT3G12640 418 / 6e-138 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G269200 [exp] 66 / 1e-12 AT3G12640 432 / 3e-143 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Potri.008G056600 [exp] 53 / 2e-08 AT3G55460 134 / 6e-38 SC35-like splicing factor 30 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009323 [exp] 254 / 3e-87 AT5G65260 268 / 2e-92 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10015840 [exp] 250 / 2e-85 AT5G65260 261 / 9e-90 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10032510 [exp] 226 / 2e-75 AT5G65260 278 / 2e-95 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10043008 [exp] 212 / 5e-70 AT5G65260 278 / 4e-96 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10032509 [exp] 221 / 2e-68 AT5G07440 771 / 0.0 glutamate dehydrogenase 2 (.1.2.3) Lus10015696 [exp] 71 / 2e-14 AT3G12640 417 / 1e-136 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Lus10037701 [exp] 70 / 6e-14 AT3G12640 412 / 2e-135 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Lus10023885 [exp] 61 / 6e-11 AT2G36660 570 / 0.0 poly(A) binding protein 7 (.1) Lus10014392 [exp] 59 / 2e-10 AT2G36660 594 / 0.0 poly(A) binding protein 7 (.1) Lus10017403 [exp] 54 / 2e-08 AT3G18610 216 / 5e-59 PARALLEL1-LIKE 1, nucleolin like 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.001G311600.1 pacid=42788494 polypeptide=Potri.001G311600.1.p locus=Potri.001G311600 ID=Potri.001G311600.1.v4.1 annot-version=v4.1 ATGGACGGTGACGATGTGGACATGGCCGCTGCAGAGACCAACGAATCTGTACCAGAACTTGATGATATGAAGAAGAGACTAAAGGAAATGGAAGATGAAG CTGCTGCTCTTCTTGAGATGCAGGCCAAGGTTGAGAAGGAAATGGGCTCTGTACAAGATCCTAGTGCTTCAGCTGCTGCATCCCAAGCAAATAGAGAGGA AGTAGATTCTCGATCAGTGTTTGTTGGTAATGTGGACTATTCGTGCACCCCTGAAGAAGTGCAGCAGCATTTTCAGGCATGTGGGACAATAAATAGGATC ACTATCCGTTCTGACAAGTATGGCCAACCAAAGGGTTATGCATATGTCGAATTCCTTGAACCAGAGACTGTGCAGGAGGCTCTCCTTCTGAATGAGTCTG AGTTACATGGCCGCCAATTGAAGGTAACTGTTAAGCGGACCAATCTACCTGGGATGAAGCAGTTTCGCGCGCGTCGACCCAACCCATATATGGGGTTTCC ACCCAGGGGCGCTCCTATGCCTCCTTATCTCTTTTCTCCTTATGGATATGGGAAGGTTCTGAGATACAGAATGCCAATGCGTTACAGCCCCTATGGCTGA
AA sequence Show only first row Show all	>Potri.001G311600.1 pacid=42788494 polypeptide=Potri.001G311600.1.p locus=Potri.001G311600 ID=Potri.001G311600.1.v4.1 annot-version=v4.1 MDGDDVDMAAAETNESVPELDDMKKRLKEMEDEAAALLEMQAKVEKEMGSVQDPSASAAASQANREEVDSRSVFVGNVDYSCTPEEVQQHFQACGTINRI TIRSDKYGQPKGYAYVEFLEPETVQEALLLNESELHGRQLKVTVKRTNLPGMKQFRARRPNPYMGFPPRGAPMPPYLFSPYGYGKVLRYRMPMRYSPYG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G65260			RNA-binding (RRM/RBD/RNP motif...		Potri.001G311600 [exp]	0	1
AT5G65260			RNA-binding (RRM/RBD/RNP motif...		Potri.017G051600 [exp]	1.00	0.8233
AT2G25910			3'-5' exonuclease domain-conta...		Potri.006G234000 [exp]	4.47	0.7241
AT4G39730			Lipase/lipooxygenase, PLAT/LH2...		Potri.007G091100 [exp]	4.89	0.7720
AT1G23750			Nucleic acid-binding, OB-fold-...		Potri.010G041000 [exp]	6.48	0.7573
AT2G18110			Translation elongation factor...		Potri.009G018600 [exp]	8.06	0.7609
AT1G13380			Protein of unknown function (D...		Potri.010G124800 [exp]	9.79	0.7653
AT3G60830		ATARP7	actin-related protein 7 (.1)		Potri.001G265200 [exp]	10.67	0.6505	ARP7.1,ARP903
AT1G79390			unknown protein		Potri.010G174700 [exp]	10.95	0.7285
AT5G12320			ankyrin repeat family protein ...		Potri.001G276100 [exp]	11.53	0.7530
AT4G33985			Protein of unknown function (D...		Potri.005G138100 [exp]	13.49	0.7127

Compare expression of checked genes

Potri.001G311600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.