Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G22380 100 / 2e-26 ATUGT85A3 UDP-glucosyl transferase 85A3 (.1) AT1G22400 96 / 4e-25 ATUGT85A1, UGT85A1 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) AT1G22340 91 / 3e-23 ATUGT85A7 UDP-glucosyl transferase 85A7 (.1) AT1G22360 89 / 3e-22 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 (.1.2) AT1G78270 87 / 7e-22 ATUGT85A4 UDP-glucosyl transferase 85A4 (.1) AT1G22370 72 / 7e-17 ATUGT85A5 UDP-glucosyl transferase 85A5 (.1.2) AT5G26310 57 / 4e-11 UGT72E3 UDP-Glycosyltransferase superfamily protein (.1) AT4G01070 56 / 8e-11 UGT72B1, GT72B1 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2) AT5G05880 56 / 1e-10 UDP-Glycosyltransferase superfamily protein (.1) AT2G36970 54 / 5e-10 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G313000 [exp] 105 / 3e-28 AT1G22360 564 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G052300 [exp] 102 / 4e-27 AT1G22360 603 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G052166 [exp] 101 / 4e-27 AT1G22360 607 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.006G023151 [exp] 100 / 9e-27 AT1G22400 521 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Potri.006G022800 [exp] 100 / 1e-26 AT1G22400 470 / 1e-163 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Potri.006G023700 [exp] 99 / 4e-26 AT1G22370 476 / 2e-165 UDP-glucosyl transferase 85A5 (.1.2) Potri.017G052232 [exp] 99 / 4e-26 AT1G22360 622 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.006G022300 [exp] 99 / 5e-26 AT1G22360 518 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G052400 [exp] 98 / 8e-26 AT1G22360 620 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000993 [exp] 98 / 1e-25 AT1G22380 563 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10031388 [exp] 96 / 5e-25 AT1G22400 644 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10010943 [exp] 96 / 7e-25 AT1G22400 535 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10013923 [exp] 96 / 7e-25 AT1G22400 537 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10041055 [exp] 94 / 4e-24 AT1G22360 610 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Lus10025741 [exp] 94 / 5e-24 AT1G22380 525 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10013924 [exp] 93 / 8e-24 AT1G22400 551 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10013925 [exp] 93 / 8e-24 AT1G22380 560 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10024584 [exp] 92 / 2e-23 AT1G22400 570 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10032218 [exp] 92 / 2e-23 AT1G22380 564 / 0.0 UDP-glucosyl transferase 85A3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0113 [poplar] [flax] GT-B PF00201 [poplar] [flax] UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Representative CDS sequence Show only first row Show all	>Potri.001G312650.1 pacid=42791599 polypeptide=Potri.001G312650.1.p locus=Potri.001G312650 ID=Potri.001G312650.1.v4.1 annot-version=v4.1 ATGGGGTGGAATTCAACAGTTGAAAGCTTGTCCTGTGGAGTGCCAATGGTTTGTTGGCCATTTTTCGCCGAGCAACAAACCACCTGCAAATTCGCTTGCA CTGAATGGGGTATTCGCAGGGGGATTGACAATAATACAAAACGAGATGAAGTGGAGAATGTAGTAAGGGAGTTAATGGATGGAGAGATAGGTAAAGAAAT GAAGAGGAAGGCATTAAAGTGGAAGAAAAAAGCATAA
AA sequence Show only first row Show all	>Potri.001G312650.1 pacid=42791599 polypeptide=Potri.001G312650.1.p locus=Potri.001G312650 ID=Potri.001G312650.1.v4.1 annot-version=v4.1 MGWNSTVESLSCGVPMVCWPFFAEQQTTCKFACTEWGIRRGIDNNTKRDEVENVVRELMDGEIGKEMKRKALKWKKKA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Potri.001G312650 [exp]	0	1
AT4G23140		RLK5, CRK6	cysteine-rich RLK (RECEPTOR-li...		Potri.004G028350 [exp]	1.00	0.8296
					Potri.016G022050 [exp]	2.23	0.7830
					Potri.003G163151 [exp]	2.44	0.8251
AT1G54470		RPP27	resistance to Peronospora para...		Potri.018G145520 [exp]	27.85	0.7013
AT5G06900		CYP93D1	"cytochrome P450, family 93, s...		Potri.005G037201 [exp]	29.52	0.7906
					Potri.014G167900 [exp]	137.79	0.7094
AT2G01150		RHA2B	RING-H2 finger protein 2B (.1)		Potri.007G086100 [exp]	239.01	0.6999

Compare expression of checked genes

Potri.001G312650 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.