Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G55570 93 / 3e-26 unknown protein AT5G41761 87 / 3e-24 unknown protein AT3G09950 66 / 1e-15 unknown protein AT3G11405 64 / 2e-14 unknown protein AT5G55620 54 / 5e-11 unknown protein AT5G06010 50 / 1e-09 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G136700 [exp] 90 / 2e-25 AT5G41761 102 / 4e-30 unknown protein Potri.001G313801 [exp] 86 / 1e-23 AT3G55570 85 / 1e-22 unknown protein Potri.002G167900 [exp] 84 / 2e-23 AT5G41761 86 / 1e-23 unknown protein Potri.012G031900 [exp] 82 / 1e-22 AT5G41761 88 / 2e-24 unknown protein Potri.014G095000 [exp] 82 / 2e-22 AT5G41761 97 / 1e-27 unknown protein Potri.014G095100 [exp] 81 / 7e-22 AT5G41761 92 / 3e-26 unknown protein Potri.006G017700 [exp] 73 / 2e-18 AT5G41761 83 / 6e-22 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012634 [exp] 82 / 6e-22 AT5G41761 85 / 6e-23 unknown protein Lus10017552 [exp] 80 / 8e-21 AT5G41761 94 / 2e-25 unknown protein Lus10000541 [exp] 78 / 1e-20 AT5G41761 96 / 2e-27 unknown protein Lus10038794 [exp] 74 / 4e-19 AT3G09950 82 / 6e-22 unknown protein Lus10039065 [exp] 72 / 4e-18 AT3G09950 85 / 6e-23 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G313700.1 pacid=42792683 polypeptide=Potri.001G313700.1.p locus=Potri.001G313700 ID=Potri.001G313700.1.v4.1 annot-version=v4.1 ATGGACAGCAAGAAAAAGAATGATGCTAATTGCTTTCAAATGCCCCTTCACTACCCCAAATACTCCATGAAAGATTACCAAACCATGCCTGAATGGCAGC TTGACAGGCTCCTTGCTGATTATGGGCTACCTGTACACAACGACTTGGCTTACAAAAGAGAGTTTGCAATGGGAGCATTTCTGTGGCCTAACTTTCAGCA AGAACAGAAGCCTTCTCCTTGA
AA sequence Show only first row Show all	>Potri.001G313700.1 pacid=42792683 polypeptide=Potri.001G313700.1.p locus=Potri.001G313700 ID=Potri.001G313700.1.v4.1 annot-version=v4.1 MDSKKKNDANCFQMPLHYPKYSMKDYQTMPEWQLDRLLADYGLPVHNDLAYKREFAMGAFLWPNFQQEQKPSP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G55570			unknown protein		Potri.001G313700 [exp]	0	1
AT1G75030		ATLP-3	thaumatin-like protein 3 (.1)		Potri.014G040700 [exp]	2.82	0.8400
AT5G49610			F-box family protein (.1)		Potri.015G028500 [exp]	3.87	0.8036
AT3G14000		ATBRXL2, BRX-LI...	DZC (Disease resistance/zinc f...		Potri.001G170800 [exp]	7.21	0.8071
AT1G03670			ankyrin repeat family protein ...		Potri.011G133300 [exp]	13.85	0.7684
					Potri.003G098301 [exp]	16.94	0.7754
					Potri.010G076150 [exp]	18.49	0.7595
AT4G24490		ATRGTA1	RAB geranylgeranyl transferase...		Potri.006G225100 [exp]	23.66	0.6527
AT3G03210			unknown protein		Potri.004G080600 [exp]	24.08	0.7546
AT1G20270			2-oxoglutarate (2OG) and Fe(II...		Potri.002G016700 [exp]	25.69	0.7513
					Potri.019G005913 [exp]	27.12	0.7380

Compare expression of checked genes

Potri.001G313700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.