Plant FIBer expression Database

Potri.001G314100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G55125 108 / 5e-33 Ribosomal protein L31 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023572
[exp]
119 / 8e-34 AT5G42250 439 / 1e-152 Zinc-binding alcohol dehydrogenase family protein (.1)
Lus10000695
[exp]
108 / 5e-33 AT5G55125 102 / 2e-30 Ribosomal protein L31 (.1.2)
PFAM info
Representative CDS sequence
>Potri.001G314100.2 pacid=42788927 polypeptide=Potri.001G314100.2.p locus=Potri.001G314100 ID=Potri.001G314100.2.v4.1 annot-version=v4.1
ATGAAGAAAGGAATCCACCCTCAAATGCAATGGATATCCTATGTGACTCAAGATGGCAGATTAATGCATGCTATGATGACAAAAATACACCATGTTGGCA
ACGTCTACCACTTCAGAGCAAAACGGCAAATGGCTGAAAGTTTAGGTCAGATTGCCAAGTTTAAGCGTCGGTACGGGCAGGAGAATGCAGAAGATGCTGA
AAAGTGA
AA sequence
>Potri.001G314100.2 pacid=42788927 polypeptide=Potri.001G314100.2.p locus=Potri.001G314100 ID=Potri.001G314100.2.v4.1 annot-version=v4.1
MKKGIHPQMQWISYVTQDGRLMHAMMTKIHHVGNVYHFRAKRQMAESLGQIAKFKRRYGQENAEDAEK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G55125 Ribosomal protein L31 (.1.2) Potri.001G314100
[exp]
0 1
AT3G18760 Translation elongation factor... Potri.018G113200
[exp]
13.56 0.7280
AT3G18165 MOS4 modifier of snc1,4 (.1) Potri.015G041800
[exp]
14.56 0.7190
AT5G45590 Ribosomal protein L35 (.1) Potri.001G133600
[exp]
15.96 0.7186
AT5G52980 unknown protein Potri.003G093800
[exp]
18.00 0.6515
AT5G07900 Mitochondrial transcription te... Potri.003G190700
[exp]
19.18 0.6809
AT4G38150 Pentatricopeptide repeat (PPR)... Potri.004G209500
[exp]
24.73 0.7080
AT3G62840 Small nuclear ribonucleoprotei... Potri.002G204300
[exp]
39.33 0.6703
AT1G31860 HISN2, AT-IE HISTIDINE BIOSYNTHESIS 2, hist... Potri.001G391400
[exp]
46.86 0.6671 Pt-IE.1
AT2G34480 Ribosomal protein L18ae/LX fam... Potri.004G063300
[exp]
49.59 0.6481 RPL18.6
AT2G20490 NOP10, EDA27 EMBRYO SAC DEVELOPMENT ARREST ... Potri.005G226300
[exp]
49.91 0.6722

Potri.001G314100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.