Potri.001G315500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G30810 91 / 4e-25 Gibberellin-regulated family protein (.1)
AT5G15230 86 / 3e-23 GASA4 GAST1 protein homolog 4 (.1.2)
AT1G74670 81 / 2e-21 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
AT2G39540 79 / 6e-21 Gibberellin-regulated family protein (.1)
AT3G02885 75 / 6e-19 GASA5 GAST1 protein homolog 5 (.1)
AT5G59845 74 / 6e-19 Gibberellin-regulated family protein (.1)
AT1G10588 69 / 1e-16 Gibberellin-regulated family protein (.1.2)
AT2G14900 66 / 2e-15 Gibberellin-regulated family protein (.1)
AT4G09600 62 / 6e-14 GASA3 GAST1 protein homolog 3 (.1)
AT1G22690 60 / 8e-13 Gibberellin-regulated family protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G254100 88 / 7e-24 AT1G74670 111 / 4e-33 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Potri.017G124200 85 / 6e-23 AT3G02885 101 / 1e-29 GAST1 protein homolog 5 (.1)
Potri.006G044400 83 / 7e-22 AT1G74670 108 / 9e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Potri.014G020100 78 / 3e-20 AT5G59845 99 / 9e-29 Gibberellin-regulated family protein (.1)
Potri.009G092600 70 / 4e-17 AT2G14900 99 / 2e-28 Gibberellin-regulated family protein (.1)
Potri.001G297700 70 / 4e-17 AT2G14900 96 / 2e-27 Gibberellin-regulated family protein (.1)
Potri.019G083900 65 / 4e-15 AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3)
Potri.017G083000 65 / 4e-15 AT5G15230 116 / 3e-35 GAST1 protein homolog 4 (.1.2)
Potri.002G022500 65 / 8e-15 AT2G18420 99 / 2e-28 Gibberellin-regulated family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029340 109 / 9e-33 AT2G30810 108 / 3e-32 Gibberellin-regulated family protein (.1)
Lus10030680 94 / 2e-26 AT5G15230 131 / 5e-41 GAST1 protein homolog 4 (.1.2)
Lus10004048 91 / 3e-25 AT1G74670 109 / 1e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Lus10018016 91 / 4e-25 AT1G74670 110 / 2e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Lus10005241 87 / 2e-23 ND 96 / 4e-27
Lus10042012 85 / 1e-22 AT1G74670 96 / 6e-27 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Lus10002059 84 / 2e-22 AT1G74670 132 / 1e-41 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Lus10042203 83 / 5e-22 AT1G74670 138 / 6e-44 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Lus10008612 82 / 6e-22 AT1G74670 138 / 8e-44 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Lus10024791 81 / 1e-21 AT5G59845 114 / 5e-35 Gibberellin-regulated family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02704 GASA Gibberellin regulated protein
Representative CDS sequence
>Potri.001G315500.1 pacid=42790931 polypeptide=Potri.001G315500.1.p locus=Potri.001G315500 ID=Potri.001G315500.1.v4.1 annot-version=v4.1
ATGGCTAAGCTCTCTTTCTCCCTCTCTGCTGCTCTCATTCTCCTTGTTGCCATGGCCTTTGTTATTGACACCTCACAAGCCGGCGGCGAGGGATCTGTTA
AATTGCAAGATTGCCCAGAAGCCTGCGATGTCCGATGCTCAGCAACCTCACACAAGAGTGCATGCACTTTCTTCTGCAACTATTGCTGCAAAAAATGCTT
GTGTGTTCCCTCAGGCACATACGGTCACAAGGATGAGTGTCCATGCTACAGAGATATGAAAACACAAGAGGGCAAACCCAAGTGCCCATGA
AA sequence
>Potri.001G315500.1 pacid=42790931 polypeptide=Potri.001G315500.1.p locus=Potri.001G315500 ID=Potri.001G315500.1.v4.1 annot-version=v4.1
MAKLSFSLSAALILLVAMAFVIDTSQAGGEGSVKLQDCPEACDVRCSATSHKSACTFFCNYCCKKCLCVPSGTYGHKDECPCYRDMKTQEGKPKCP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G30810 Gibberellin-regulated family p... Potri.001G315500 0 1

Potri.001G315500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.