Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G13850 137 / 2e-42 ATGRP2, GR-RBP2 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) AT3G23830 136 / 2e-42 AtGRP4, GR-RBP4, GRP4 glycine-rich RNA-binding protein 4 (.1.2) AT5G61030 120 / 7e-34 GR-RBP3 glycine-rich RNA-binding protein 3 (.1) AT1G74230 115 / 4e-32 GR-RBP5 glycine-rich RNA-binding protein 5 (.1) AT5G47320 97 / 1e-25 RPS19 ribosomal protein S19 (.1) AT3G08000 88 / 6e-23 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT4G24770 90 / 2e-22 CP31, ATRBP33, ATRBP31, RBP31 ARABIDOPSIS THALIANA RNA BINDING PROTEIN, APPROXIMATELY 31 KD, 31-kDa RNA binding protein (.1) AT2G37220 87 / 3e-21 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G50250 86 / 8e-21 CP31B chloroplast RNA-binding protein 31B (.1) AT2G21660 82 / 1e-20 CCR2, ATGRP7, GR-RBP7 GLYCINE-RICH RNA-BINDING PROTEIN 7, "cold, circadian rhythm, and rna binding 2", GLYCINE RICH PROTEIN 7, cold, circadian rhythm, and rna binding 2 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G319900 [exp] 216 / 1e-73 AT4G13850 140 / 1e-43 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Potri.017G059000 [exp] 187 / 1e-62 AT4G13850 134 / 9e-42 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Potri.015G057400 [exp] 128 / 9e-38 AT5G61030 157 / 8e-47 glycine-rich RNA-binding protein 3 (.1) Potri.012G061600 [exp] 127 / 2e-37 AT5G61030 181 / 9e-56 glycine-rich RNA-binding protein 3 (.1) Potri.014G157300 [exp] 88 / 3e-23 AT3G08000 129 / 2e-39 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.004G155300 [exp] 88 / 8e-23 AT2G21660 145 / 3e-45 GLYCINE-RICH RNA-BINDING PROTEIN 7, "cold, circadian rhythm, and rna binding 2", GLYCINE RICH PROTEIN 7, cold, circadian rhythm, and rna binding 2 (.1.2) Potri.001G340800 [exp] 88 / 5e-22 AT4G24770 322 / 2e-110 ARABIDOPSIS THALIANA RNA BINDING PROTEIN, APPROXIMATELY 31 KD, 31-kDa RNA binding protein (.1) Potri.009G116400 [exp] 86 / 5e-22 AT2G21660 145 / 5e-45 GLYCINE-RICH RNA-BINDING PROTEIN 7, "cold, circadian rhythm, and rna binding 2", GLYCINE RICH PROTEIN 7, cold, circadian rhythm, and rna binding 2 (.1.2) Potri.012G090200 [exp] 86 / 1e-20 AT4G24770 310 / 7e-105 ARABIDOPSIS THALIANA RNA BINDING PROTEIN, APPROXIMATELY 31 KD, 31-kDa RNA binding protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032591 [exp] 165 / 2e-53 AT4G13850 157 / 5e-50 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Lus10022551 [exp] 157 / 2e-50 AT4G13850 167 / 7e-54 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Lus10043158 [exp] 155 / 2e-49 AT4G13850 154 / 1e-48 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Lus10016639 [exp] 154 / 3e-49 AT4G13850 166 / 1e-53 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Lus10021154 [exp] 137 / 1e-40 AT5G61030 188 / 5e-58 glycine-rich RNA-binding protein 3 (.1) Lus10040519 [exp] 135 / 1e-37 AT5G61030 189 / 2e-53 glycine-rich RNA-binding protein 3 (.1) Lus10017852 [exp] 121 / 4e-35 AT5G61030 178 / 7e-55 glycine-rich RNA-binding protein 3 (.1) Lus10034685 [exp] 120 / 4e-34 AT5G61030 177 / 7e-54 glycine-rich RNA-binding protein 3 (.1) Lus10031534 [exp] 91 / 4e-24 AT3G08000 146 / 2e-46 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10015146 [exp] 90 / 4e-24 AT3G08000 145 / 5e-46 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.001G319800.2 pacid=42789244 polypeptide=Potri.001G319800.2.p locus=Potri.001G319800 ID=Potri.001G319800.2.v4.1 annot-version=v4.1 ATGGCATTCTTTAACAAGCTCGGGAGCCTAGCGAGGCAGTCAATTTCCCAGAAGGGGCAAGTTCCAATGGTGTCCATGTTGAACACTATTCGCTGCATGT CGTCATCCAAGCTTTTCATTGGAGGGCTTCCATGGTCAGCTGATGACCATACTCTTAAGGAAGCATTTTCTGGCTATGGGGAAGTGATAGAGGCAAGGGT TATCATGGATAGAGAGACTGGGAGATCTCGTGGATTTGGGTTTGTTAGTTATGATAGCAGTGAATCTGCCAGTGAAGCACAATCAGCAATGGATGGCCAG GAGCTGGGTGGAAGAAATGTTCGCGTGTCCTTTGCTGAGGAAAGGAGCCGACCACCACGATCTTACAATGACGATTACCAAGGGAATCGAGGTTATGATA ATTGA
AA sequence Show only first row Show all	>Potri.001G319800.2 pacid=42789244 polypeptide=Potri.001G319800.2.p locus=Potri.001G319800 ID=Potri.001G319800.2.v4.1 annot-version=v4.1 MAFFNKLGSLARQSISQKGQVPMVSMLNTIRCMSSSKLFIGGLPWSADDHTLKEAFSGYGEVIEARVIMDRETGRSRGFGFVSYDSSESASEAQSAMDGQ ELGGRNVRVSFAEERSRPPRSYNDDYQGNRGYDN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G13850		ATGRP2, GR-RBP2	glycine rich protein 2, glycin...		Potri.001G319800 [exp]	0	1
AT3G44750		HDT1, HDA3, ATH...	HISTONE DEACETYLASE 2A, histon...		Potri.009G149400 [exp]	1.00	0.9057	HD2.2,HDT901
AT3G13160			Tetratricopeptide repeat (TPR)...		Potri.004G029900 [exp]	1.73	0.8728
AT1G80270		PPR596	PENTATRICOPEPTIDE REPEAT 596 (...		Potri.016G036100 [exp]	2.00	0.8739
AT5G57120			unknown protein		Potri.018G140200 [exp]	3.16	0.8578
AT4G21130		EMB2271	EMBRYO DEFECTIVE 2271, Transdu...		Potri.005G061000 [exp]	6.32	0.8598
AT5G26830			Threonyl-tRNA synthetase (.1)		Potri.008G145600 [exp]	6.85	0.7889	THRRS.1
AT2G27775			unknown protein		Potri.009G148400 [exp]	8.66	0.8249
AT1G56110		NOP56	homolog of nucleolar protein N...		Potri.012G095400 [exp]	8.83	0.8299	NOP56.2
AT3G10110		MEE67	maternal effect embryo arrest ...		Potri.009G076400 [exp]	8.94	0.8481
AT4G35850			Pentatricopeptide repeat (PPR)...		Potri.001G341400 [exp]	9.79	0.8315

Compare expression of checked genes

Potri.001G319800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.