Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G23805 96 / 2e-26 RALFL24 ralf-like 24 (.1) AT4G13950 96 / 2e-26 RALFL31 ralf-like 31 (.1) AT3G05490 69 / 7e-16 RALFL22 ralf-like 22 (.1) AT3G16570 67 / 4e-15 ATRALF23, RALFL23 ARABIDOPSIS RAPID ALKALINIZATION FACTOR 23, rapid alkalinization factor 23 (.1) AT4G15800 66 / 5e-15 RALFL33 ralf-like 33 (.1) AT1G02900 65 / 2e-14 RALF1, RALFL1, ATRALF1 RALF-LIKE 1, rapid alkalinization factor 1 (.1) AT2G33775 62 / 3e-13 RALFL19 ralf-like 19 (.1) AT1G28270 56 / 4e-11 RALFL4 ralf-like 4 (.1) AT5G67070 44 / 2e-06 RALFL34 ralf-like 34 (.1) AT1G60625 37 / 0.0003 RALFL6 RALF-like 6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G059500 [exp] 138 / 7e-43 AT4G13950 96 / 2e-26 ralf-like 31 (.1) Potri.004G044900 [exp] 66 / 6e-15 AT1G28270 103 / 4e-30 ralf-like 4 (.1) Potri.004G045000 [exp] 66 / 8e-15 AT1G28270 103 / 4e-30 ralf-like 4 (.1) Potri.008G208200 [exp] 62 / 2e-13 AT4G15800 132 / 2e-41 ralf-like 33 (.1) Potri.005G025800 [exp] 61 / 6e-13 AT4G15800 138 / 1e-43 ralf-like 33 (.1) Potri.013G017400 [exp] 61 / 1e-12 AT4G15800 123 / 1e-37 ralf-like 33 (.1) Potri.014G131800 [exp] 58 / 9e-12 AT4G15800 123 / 1e-37 ralf-like 33 (.1) Potri.007G044700 [exp] 41 / 3e-05 AT5G67070 119 / 1e-35 ralf-like 34 (.1) Potri.005G139100 [exp] 40 / 9e-05 AT5G67070 118 / 4e-35 ralf-like 34 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016646 [exp] 93 / 2e-25 AT4G13950 100 / 1e-28 ralf-like 31 (.1) Lus10022561 [exp] 91 / 1e-24 AT4G13950 100 / 1e-28 ralf-like 31 (.1) Lus10020647 [exp] 70 / 4e-16 AT4G15800 119 / 5e-36 ralf-like 33 (.1) Lus10029893 [exp] 69 / 7e-16 AT4G15800 116 / 8e-35 ralf-like 33 (.1) Lus10000502 [exp] 62 / 2e-13 AT4G15800 134 / 1e-41 ralf-like 33 (.1) Lus10037512 [exp] 62 / 2e-13 AT4G15800 131 / 9e-41 ralf-like 33 (.1) Lus10015172 [exp] 62 / 3e-13 AT4G15800 107 / 2e-31 ralf-like 33 (.1) Lus10005541 [exp] 52 / 1e-09 AT1G28270 69 / 3e-16 ralf-like 4 (.1) Lus10025444 [exp] 52 / 2e-09 AT1G28270 100 / 2e-28 ralf-like 4 (.1) Lus10015316 [exp] 52 / 2e-09 AT1G28270 100 / 7e-29 ralf-like 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05498 [poplar] [flax] RALF Rapid ALkalinization Factor (RALF)
Representative CDS sequence Show only first row Show all	>Potri.001G320700.1 pacid=42791915 polypeptide=Potri.001G320700.1.p locus=Potri.001G320700 ID=Potri.001G320700.1.v4.1 annot-version=v4.1 ATGTCCGAACACCAGCTTTTCCCTCATACTCCCACACTACTCTACCTTTCACTGCTTTTCCTCCTCACCCTTTTCACAATTTGCAATGCTGATTCAGTTT CAGGCCTCAATTCACTGAAAACCAGTGAGATTGATGCCATTGTCAGTAAGGGTTGCTCAGAGAAAATTGGAGAGTGCTTTGAAGAGTCAGAAATGGAGTC AGAGATCAGCAGGAGAGTGTTGCTGATGCACAAGAAGTACATAAGTTATGAGACACTGAGGAGGGACTTGGTTCCCTGTGATAAACCAGGAGCATCATAC TATGACTGCAATGCTAGACAGGCTCATCCTTATAACAGAGGCTGTGAGGTCATTACAAGGTGTGCAAGAAGCGTCAAGGACATTAACAATTAG
AA sequence Show only first row Show all	>Potri.001G320700.1 pacid=42791915 polypeptide=Potri.001G320700.1.p locus=Potri.001G320700 ID=Potri.001G320700.1.v4.1 annot-version=v4.1 MSEHQLFPHTPTLLYLSLLFLLTLFTICNADSVSGLNSLKTSEIDAIVSKGCSEKIGECFEESEMESEISRRVLLMHKKYISYETLRRDLVPCDKPGASY YDCNARQAHPYNRGCEVITRCARSVKDINN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G23805		RALFL24	ralf-like 24 (.1)		Potri.001G320700 [exp]	0	1
AT1G12845			unknown protein		Potri.017G060400 [exp]	1.00	0.8613
AT5G08335		ATICMTB, ATSTE1...	ARABIDOPSIS THALIANA ISOPRENYL...		Potri.007G074500 [exp]	2.23	0.8125
AT3G50410	DOF	OBP1, AtDof3. 4	OBF binding protein 1 (.1)		Potri.007G036400 [exp]	2.44	0.8527	Pt-OBP1.1
AT5G59350			unknown protein		Potri.010G206100 [exp]	9.79	0.8239
AT1G04635		EMB1687	EMBRYO DEFECTIVE 1687, ribonuc...		Potri.015G001000 [exp]	10.95	0.7954
AT4G28600		NPGR2	no pollen germination related ...		Potri.010G068700 [exp]	13.67	0.7747	Pt-NPGR2.1
AT4G21450			PapD-like superfamily protein ...		Potri.019G116400 [exp]	14.00	0.7944
AT1G01580		FRD1, ATFRO2, F...	FERRIC CHELATE REDUCTASE DEFEC...		Potri.004G079100 [exp]	14.42	0.7756
AT1G46264	HSF	SCZ, AT-HSFB4	SCHIZORIZA, heat shock transcr...		Potri.001G273700 [exp]	15.58	0.7800
AT3G61920			unknown protein		Potri.002G178900 [exp]	16.88	0.7757

Compare expression of checked genes

Potri.001G320700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.