Potri.001G321300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G14010 61 / 7e-13 RALFL32 ralf-like 32 (.1)
AT4G15800 41 / 2e-05 RALFL33 ralf-like 33 (.1)
AT1G02900 40 / 5e-05 RALF1, RALFL1, ATRALF1 RALF-LIKE 1, rapid alkalinization factor 1 (.1)
AT2G33775 36 / 0.001 RALFL19 ralf-like 19 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G059800 130 / 1e-40 AT4G14010 70 / 1e-16 ralf-like 32 (.1)
Potri.001G321500 45 / 4e-07 AT4G14010 54 / 3e-10 ralf-like 32 (.1)
Potri.017G059900 45 / 6e-07 AT4G14010 45 / 4e-07 ralf-like 32 (.1)
Potri.005G025800 42 / 6e-06 AT4G15800 138 / 1e-43 ralf-like 33 (.1)
Potri.014G131800 41 / 2e-05 AT4G15800 123 / 1e-37 ralf-like 33 (.1)
Potri.017G059500 41 / 3e-05 AT4G13950 96 / 2e-26 ralf-like 31 (.1)
Potri.008G208200 39 / 7e-05 AT4G15800 132 / 2e-41 ralf-like 33 (.1)
Potri.004G044900 38 / 0.0003 AT1G28270 103 / 4e-30 ralf-like 4 (.1)
Potri.004G045000 37 / 0.0004 AT1G28270 103 / 4e-30 ralf-like 4 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008885 57 / 3e-11 AT4G14010 82 / 2e-21 ralf-like 32 (.1)
Lus10023223 55 / 1e-10 AT4G14010 83 / 2e-21 ralf-like 32 (.1)
Lus10000502 44 / 2e-06 AT4G15800 134 / 1e-41 ralf-like 33 (.1)
Lus10037512 44 / 2e-06 AT4G15800 131 / 9e-41 ralf-like 33 (.1)
Lus10015172 38 / 0.0003 AT4G15800 107 / 2e-31 ralf-like 33 (.1)
Lus10020647 37 / 0.001 AT4G15800 119 / 5e-36 ralf-like 33 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05498 RALF Rapid ALkalinization Factor (RALF)
Representative CDS sequence
>Potri.001G321300.2 pacid=42793722 polypeptide=Potri.001G321300.2.p locus=Potri.001G321300 ID=Potri.001G321300.2.v4.1 annot-version=v4.1
ATGGAACGGAAGTGCTTCCCACATTTCTGTTTCCTTCTAGTGATCTTGAGCCTTGTAATATTGCAGCTCGGCGACAAGCTGGTGGCGTCGAAAACGAATG
GATGCAATGGTTCGATAGCAGAATGCGATGAAGAATACGAGTTCTTGATGCCATCTCATGTTAGTAAAAGGTATCTTGAAGAGAAGAGGAAGTATATATC
ACCTGGTGCTTTAAAGCCAGACCAGCCAGTTTGTAATGAAGGCGCTAGTGGTCAGTCTTATAGTAGTAGTTGTCTTCCACCTCCATCTAATTCTCCTTCT
CGCGGTTGTTCCAAGTACTATCGTTGCAGGTCTGATGATTGA
AA sequence
>Potri.001G321300.2 pacid=42793722 polypeptide=Potri.001G321300.2.p locus=Potri.001G321300 ID=Potri.001G321300.2.v4.1 annot-version=v4.1
MERKCFPHFCFLLVILSLVILQLGDKLVASKTNGCNGSIAECDEEYEFLMPSHVSKRYLEEKRKYISPGALKPDQPVCNEGASGQSYSSSCLPPPSNSPS
RGCSKYYRCRSDD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G14010 RALFL32 ralf-like 32 (.1) Potri.001G321300 0 1
AT1G61250 SC3 secretory carrier 3 (.1.2) Potri.004G036600 3.46 0.8876
AT4G38580 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPREN... Potri.009G135300 8.00 0.8585
AT3G54190 Transducin/WD40 repeat-like su... Potri.006G113000 14.69 0.8280
AT4G40045 unknown protein Potri.008G025700 18.46 0.8569
AT5G04800 Ribosomal S17 family protein (... Potri.016G073750 20.19 0.8416
AT2G33060 AtRLP27 receptor like protein 27 (.1) Potri.010G009400 21.90 0.8515
AT3G50810 Uncharacterised protein family... Potri.004G149332 25.78 0.8398
AT3G24030 hydroxyethylthiazole kinase fa... Potri.001G053900 28.91 0.8271
AT2G30580 BMI1A, DRIP2 DREB2A-interacting protein 2 (... Potri.005G054100 33.16 0.8368
AT2G37150 RING/U-box superfamily protein... Potri.008G041201 34.72 0.8573

Potri.001G321300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.