Potri.001G324600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G14010 75 / 5e-17 C2H2ZnF KNUCKLES, KNU KNUCKLES, C2H2 and C2HC zinc fingers superfamily protein (.1)
AT1G66140 59 / 1e-10 C2H2ZnF ZFP4 zinc finger protein 4 (.1)
AT1G80730 59 / 1e-10 C2H2ZnF ATZFP1, ZFP1 ARABIDOPSIS THALIANA ZINC-FINGER PROTEIN 1, zinc-finger protein 1 (.1)
AT1G24625 58 / 2e-10 C2H2ZnF ZFP7 zinc finger protein 7 (.1)
AT5G57520 56 / 4e-10 C2H2ZnF ATZFP2, ZFP2 zinc finger protein 2 (.1)
AT5G48890 56 / 9e-10 C2H2ZnF LATE LATE FLOWERING, C2H2-like zinc finger protein (.1)
AT1G68360 57 / 1e-09 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1)
AT5G25160 56 / 1e-09 C2H2ZnF ZFP3 zinc finger protein 3 (.1)
AT1G67030 56 / 1e-09 C2H2ZnF ZFP6 zinc finger protein 6 (.1)
AT5G10970 56 / 2e-09 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G097900 64 / 9e-13 AT1G67030 100 / 2e-26 zinc finger protein 6 (.1)
Potri.001G298700 64 / 1e-12 AT1G24625 86 / 1e-20 zinc finger protein 7 (.1)
Potri.014G178200 63 / 2e-12 AT5G48890 61 / 1e-11 LATE FLOWERING, C2H2-like zinc finger protein (.1)
Potri.009G093300 63 / 2e-12 AT1G24625 89 / 6e-22 zinc finger protein 7 (.1)
Potri.002G238700 62 / 4e-12 AT5G48890 71 / 1e-15 LATE FLOWERING, C2H2-like zinc finger protein (.1)
Potri.017G116300 60 / 5e-11 AT1G68360 99 / 6e-25 C2H2 and C2HC zinc fingers superfamily protein (.1)
Potri.006G261700 59 / 1e-10 AT5G10970 166 / 4e-50 C2H2 and C2HC zinc fingers superfamily protein (.1)
Potri.018G021400 59 / 1e-10 AT5G10970 165 / 8e-50 C2H2 and C2HC zinc fingers superfamily protein (.1)
Potri.008G138000 59 / 1e-10 AT1G66140 155 / 2e-46 zinc finger protein 4 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035169 66 / 2e-13 AT1G66140 66 / 4e-14 zinc finger protein 4 (.1)
Lus10011884 62 / 5e-12 AT5G14010 67 / 5e-14 KNUCKLES, C2H2 and C2HC zinc fingers superfamily protein (.1)
Lus10013243 61 / 7e-11 AT1G66140 125 / 3e-34 zinc finger protein 4 (.1)
Lus10030764 61 / 8e-11 AT1G66140 124 / 1e-33 zinc finger protein 4 (.1)
Lus10022816 59 / 8e-11 AT5G14010 65 / 1e-13 KNUCKLES, C2H2 and C2HC zinc fingers superfamily protein (.1)
Lus10026597 58 / 1e-10 AT1G66140 85 / 1e-20 zinc finger protein 4 (.1)
Lus10018328 58 / 1e-10 AT5G10970 94 / 6e-24 C2H2 and C2HC zinc fingers superfamily protein (.1)
Lus10025471 57 / 3e-10 AT5G57520 92 / 3e-24 zinc finger protein 2 (.1)
Lus10010388 58 / 4e-10 AT1G24625 88 / 4e-21 zinc finger protein 7 (.1)
Lus10014350 57 / 5e-10 AT1G80730 110 / 1e-29 ARABIDOPSIS THALIANA ZINC-FINGER PROTEIN 1, zinc-finger protein 1 (.1)
PFAM info
Representative CDS sequence
>Potri.001G324600.1 pacid=42793170 polypeptide=Potri.001G324600.1.p locus=Potri.001G324600 ID=Potri.001G324600.1.v4.1 annot-version=v4.1
ATGGCAGACCCATCAATCTTCAACTTCCTCAACCATCAACACCAACAGTACCCTTCTTCTTCTTCTTCTTCAAAACCCACAAAGAAAAGCTCAACAAACC
TACCCCAACCCTCCTCTTCTCGTCACTTTCCATGTCTGTACTGTCCTCGCAGGTTCTACACCTCTCAAGCTCTTGGTGGCCATCAAAATGCCCACAAACG
TGAAAGAGCTGCTCTAAGAAGAAACAACACCACCCTCAACACTAGCATCTCAACAGACCCTTCTTTGATTATACCTTCATCATTTCTTAACCATAACCTC
CCACCGCCAGCAAGTACTCCTGCAGTGCCCTTTTTTAACCAATACCACCGATATCATCAGCAGGCACTAGACCACCCCATGATGATTACCAACTACCAGT
TTCCAGCACCACCCAGTACAAATGGTGTCTATGTTTCGGCTCCTCATTATGGTGGGCTTTATGGTGTCTCTGCAGCTGCTACTTCTCTTGATCATGATAT
TGGTAGTACTGGTAGTGGTTATGATCTTTCAACAAGTACTGATAATGATGATCCTAATGACCCTACAAATATTGACCTTACCCTCCGTTTATAA
AA sequence
>Potri.001G324600.1 pacid=42793170 polypeptide=Potri.001G324600.1.p locus=Potri.001G324600 ID=Potri.001G324600.1.v4.1 annot-version=v4.1
MADPSIFNFLNHQHQQYPSSSSSSKPTKKSSTNLPQPSSSRHFPCLYCPRRFYTSQALGGHQNAHKRERAALRRNNTTLNTSISTDPSLIIPSSFLNHNL
PPPASTPAVPFFNQYHRYHQQALDHPMMITNYQFPAPPSTNGVYVSAPHYGGLYGVSAAATSLDHDIGSTGSGYDLSTSTDNDDPNDPTNIDLTLRL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G14010 C2H2ZnF KNUCKLES, KNU KNUCKLES, C2H2 and C2HC zinc f... Potri.001G324600 0 1
AT5G58850 MYB ATMYB119 myb domain protein 119 (.1) Potri.001G250000 5.29 0.7655
Potri.001G339700 5.56 0.7204
AT2G17570 Undecaprenyl pyrophosphate syn... Potri.002G039400 6.63 0.8580
AT3G09510 Ribonuclease H-like superfamil... Potri.004G015067 8.00 0.8436
Potri.006G122650 9.16 0.8296
AT2G28305 ATLOG1 LONELY GUY 1, Putative lysine ... Potri.004G212200 9.79 0.7891
AT4G02810 FAF1 FANTASTIC FOUR 1, Protein of u... Potri.002G053400 12.24 0.8337
Potri.001G282604 15.19 0.8179
Potri.014G104750 15.55 0.7981
AT2G15180 Zinc knuckle (CCHC-type) famil... Potri.001G006850 16.00 0.8135

Potri.001G324600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.