NAC114 (Potri.001G325100) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol NAC114
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G13180 162 / 2e-49 NAC VNDIP2, ANAC083, VNI2 VND-interacting 2, NAC domain containing protein 83 (.1)
AT2G33480 149 / 8e-44 NAC ANAC041 NAC domain containing protein 41 (.1.2)
AT5G14000 141 / 9e-42 NAC ANAC084 NAC domain containing protein 84 (.1)
AT3G15510 122 / 9e-33 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
AT1G77450 114 / 2e-30 NAC ANAC032 NAC domain containing protein 32 (.1)
AT1G01720 114 / 3e-30 NAC ATAF1, ANAC002 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
AT1G61110 114 / 6e-30 NAC ANAC025 NAC domain containing protein 25 (.1)
AT3G04060 114 / 8e-30 NAC ANAC046 NAC domain containing protein 46 (.1)
AT3G04070 112 / 3e-29 NAC ANAC047 NAC domain containing protein 47 (.1.2)
AT5G39610 111 / 3e-29 NAC ORE1, AtNAC2, ANAC092, ATNAC6 ORESARA 1, NAC domain containing protein 2, Arabidopsis NAC domain containing protein 92, NAC domain containing protein 6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G063300 398 / 3e-142 AT5G13180 150 / 9e-45 VND-interacting 2, NAC domain containing protein 83 (.1)
Potri.003G166500 194 / 1e-61 AT5G13180 310 / 4e-107 VND-interacting 2, NAC domain containing protein 83 (.1)
Potri.001G061200 187 / 1e-58 AT5G13180 310 / 6e-107 VND-interacting 2, NAC domain containing protein 83 (.1)
Potri.015G102100 153 / 9e-46 AT5G13180 232 / 8e-77 VND-interacting 2, NAC domain containing protein 83 (.1)
Potri.012G103500 149 / 4e-44 AT5G13180 229 / 2e-75 VND-interacting 2, NAC domain containing protein 83 (.1)
Potri.011G046700 125 / 9e-34 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1)
Potri.013G054000 123 / 3e-33 AT3G04070 338 / 9e-115 NAC domain containing protein 47 (.1.2)
Potri.001G404400 123 / 3e-33 AT3G15510 345 / 1e-117 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
Potri.002G081000 122 / 3e-33 AT1G01720 416 / 5e-148 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002581 188 / 3e-59 AT5G13180 273 / 6e-93 VND-interacting 2, NAC domain containing protein 83 (.1)
Lus10041534 186 / 2e-58 AT2G33480 125 / 1e-34 NAC domain containing protein 41 (.1.2)
Lus10001809 181 / 1e-56 AT5G13180 271 / 6e-92 VND-interacting 2, NAC domain containing protein 83 (.1)
Lus10012557 169 / 7e-52 AT5G14000 122 / 4e-34 NAC domain containing protein 84 (.1)
Lus10032004 159 / 9e-48 AT5G14000 113 / 2e-30 NAC domain containing protein 84 (.1)
Lus10035174 154 / 5e-46 AT5G14000 115 / 2e-31 NAC domain containing protein 84 (.1)
Lus10032657 124 / 4e-33 AT3G15510 353 / 1e-120 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
Lus10043095 122 / 1e-32 AT3G15510 351 / 1e-119 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
Lus10006547 121 / 3e-32 AT3G04070 337 / 4e-114 NAC domain containing protein 47 (.1.2)
Lus10011215 121 / 3e-32 AT1G61110 305 / 1e-102 NAC domain containing protein 25 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02365 NAM No apical meristem (NAM) protein
Representative CDS sequence
>Potri.001G325100.1 pacid=42793721 polypeptide=Potri.001G325100.1.p locus=Potri.001G325100 ID=Potri.001G325100.1.v4.1 annot-version=v4.1
ATGGAAAGGCCAAACTTTGTTGAGAATGGAGGGCTCAGATTGCCTATTGGATATAGGTTTCATCCAACGGATGAAGAGCTTGTTGTTCATTACCTGAAGC
GAAAGGTCCTTGGTCTTCCATTGCCAGCTGCTGTCATTCCTGAGTTTGATGTATTCCAAACTGATCCTTGGAGCTTGCCAGGTAATTTGAAGGAAAAGAG
GTACTTCTTTAGCCAAAAGAAGTTGAATGACTTTGGAACAAAATGCAAGAGATCCGCTGGTTATATACCTTCTGGTTACTGGAAACCCGTTGGGAAAGGC
AAGCAAATTGTAGCTTCTGGTAGCAACCAAGCAGTTGGAATAAGGAAAACGCTGGTTTTCAGAGAAAGAAATCATTCTAGTAAGACTAGAACTCAATGGG
TGATGCATGAATATTGCCTTGTAGGCTTGCCAACAGACCCCAAAACCACCCAGATGAAAGTGGGAGATTGGGTTGCTAACAGTATATTTCACAGGAAGAG
GAAACCTAAAAACCATGTGGTCATGATTTCCAACCCTTCAAACATTAACAAGAGGCAAAATGTCGAGATTATTAGTCCTAGTTTCATGGATTTTATGATG
GAACAAAGCTCTGATGAAGCTGGTGCTCCTTCACAATGTTCAAGTGGAGTCACCGAGGTGTCTTCTAATGAGTTTGATCAGGAAGAAATCAGTTCCTTCA
TTAGCCTGTTTACTTATCCTTGTAAGAGGAAGAGGACTTGA
AA sequence
>Potri.001G325100.1 pacid=42793721 polypeptide=Potri.001G325100.1.p locus=Potri.001G325100 ID=Potri.001G325100.1.v4.1 annot-version=v4.1
MERPNFVENGGLRLPIGYRFHPTDEELVVHYLKRKVLGLPLPAAVIPEFDVFQTDPWSLPGNLKEKRYFFSQKKLNDFGTKCKRSAGYIPSGYWKPVGKG
KQIVASGSNQAVGIRKTLVFRERNHSSKTRTQWVMHEYCLVGLPTDPKTTQMKVGDWVANSIFHRKRKPKNHVVMISNPSNINKRQNVEIISPSFMDFMM
EQSSDEAGAPSQCSSGVTEVSSNEFDQEEISSFISLFTYPCKRKRT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G13180 NAC VNDIP2, ANAC083... VND-interacting 2, NAC domain ... Potri.001G325100 0 1 NAC114
AT5G09360 LAC14 laccase 14 (.1) Potri.019G088800 8.00 0.8876
AT3G45640 ATMAPK3, ATMPK3 mitogen-activated protein kina... Potri.009G066100 8.71 0.8808 Pt-MPK3.2
Potri.018G078801 9.00 0.8699
AT5G66210 CPK28 calcium-dependent protein kina... Potri.005G113600 13.78 0.8566 CPK18
AT2G01670 ATNUDT17 nudix hydrolase homolog 17 (.1... Potri.008G134000 14.31 0.8696
AT2G01670 ATNUDT17 nudix hydrolase homolog 17 (.1... Potri.010G107300 14.69 0.8102
Potri.012G007100 16.06 0.8660
AT2G32300 UCC1 uclacyanin 1 (.1) Potri.018G129200 18.54 0.8698
AT2G26640 KCS11 3-ketoacyl-CoA synthase 11 (.1... Potri.018G032200 20.49 0.7913
AT5G64300 ATGCH, ATRIBA1,... RED FLUORESCENT IN DARKNESS 1,... Potri.001G310500 24.79 0.8245

Potri.001G325100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.