Plant FIBer expression Database

Pt-ATGP4.2 (Potri.001G325900) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-ATGP4.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G26980 169 / 7e-56 MUB4 membrane-anchored ubiquitin-fold protein 4 precursor (.1)
AT4G24990 162 / 7e-53 ATGP4 Ubiquitin family protein (.1)
AT1G77870 129 / 5e-40 MUB5 membrane-anchored ubiquitin-fold protein 5 precursor (.1)
AT1G22050 124 / 4e-38 MUB6 membrane-anchored ubiquitin-fold protein 6 precursor (.1)
AT5G15460 118 / 1e-35 MUB2 membrane-anchored ubiquitin-fold protein 2 (.1.2)
AT3G01050 103 / 7e-30 MUB1 membrane-anchored ubiquitin-fold protein 1 precursor (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G068100
[exp]
188 / 3e-63 AT3G26980 154 / 1e-49 membrane-anchored ubiquitin-fold protein 4 precursor (.1)
Potri.012G103100
[exp]
164 / 7e-54 AT4G24990 207 / 5e-71 Ubiquitin family protein (.1)
Potri.015G101200
[exp]
153 / 2e-49 AT4G24990 197 / 6e-67 Ubiquitin family protein (.1)
Potri.004G124600
[exp]
124 / 4e-38 AT3G01050 155 / 2e-50 membrane-anchored ubiquitin-fold protein 1 precursor (.1)
Potri.017G090700
[exp]
124 / 9e-38 AT3G01050 157 / 7e-51 membrane-anchored ubiquitin-fold protein 1 precursor (.1)
Potri.002G091800
[exp]
112 / 3e-33 AT1G22050 124 / 5e-38 membrane-anchored ubiquitin-fold protein 6 precursor (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032014
[exp]
175 / 4e-58 AT3G26980 174 / 9e-58 membrane-anchored ubiquitin-fold protein 4 precursor (.1)
Lus10035184
[exp]
174 / 1e-57 AT3G26980 178 / 3e-59 membrane-anchored ubiquitin-fold protein 4 precursor (.1)
Lus10012555
[exp]
187 / 5e-56 AT5G13990 608 / 0.0 exocyst subunit exo70 family protein C2 (.1)
Lus10041539
[exp]
170 / 8e-56 AT3G26980 168 / 4e-55 membrane-anchored ubiquitin-fold protein 4 precursor (.1)
Lus10030704
[exp]
117 / 3e-35 AT5G15460 150 / 2e-48 membrane-anchored ubiquitin-fold protein 2 (.1.2)
Lus10013190
[exp]
117 / 7e-35 AT5G15460 150 / 8e-48 membrane-anchored ubiquitin-fold protein 2 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF13881 Rad60-SLD_2 Ubiquitin-2 like Rad60 SUMO-like
Representative CDS sequence
>Potri.001G325900.2 pacid=42791212 polypeptide=Potri.001G325900.2.p locus=Potri.001G325900 ID=Potri.001G325900.2.v4.1 annot-version=v4.1
ATGCCAGAGGAAGAGGAGTTAGTTGAGCTCAAGTTTAGATTGTATGATGGATCCGATATCGGTCCTTTTAGGTATTCACCTGCATCCACTGTTGCTATGC
TCAAAGAAAGAATCGTCGCCGACTGGCCTAAAGATAAAAAAATTGCACCGAAGGCAGCAAATGATGTCAAACTGATAAATGCTGGGAAAATCCTGGAAAA
CAACAAGACCGTTGGCCAGTGTAGGGTTCCTTTTGGGGACCTCCCAAAAGGGGTCATTACCATGCATGTTGTTGTCCAGCCATCTTTAGCCAAAGCAAAA
GCAGAGAAGAAGGTAGACGATGCCCCAAGAAAAAAGTTCTGTTCATGTTCCATATTATAA
AA sequence
>Potri.001G325900.2 pacid=42791212 polypeptide=Potri.001G325900.2.p locus=Potri.001G325900 ID=Potri.001G325900.2.v4.1 annot-version=v4.1
MPEEEELVELKFRLYDGSDIGPFRYSPASTVAMLKERIVADWPKDKKIAPKAANDVKLINAGKILENNKTVGQCRVPFGDLPKGVITMHVVVQPSLAKAK
AEKKVDDAPRKKFCSCSIL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G26980 MUB4 membrane-anchored ubiquitin-fo... Potri.001G325900
[exp]
0 1 Pt-ATGP4.2
AT2G25720 unknown protein Potri.004G068400
[exp]
6.70 0.9026
AT2G34500 CYP710A1 cytochrome P450, family 710, s... Potri.004G131700
[exp]
7.34 0.9384 CYP710.1
ATCG00820 ATCG00820.1, RP... ribosomal protein S19 (.1) Potri.005G154674
[exp]
11.83 0.9378
ATCG01310 ATCG01310.1, RP... ribosomal protein L2 (.1) Potri.011G074401
[exp]
16.97 0.9369
ATCG01310 ATCG01310.1, RP... ribosomal protein L2 (.1) Potri.013G136466
[exp]
21.81 0.9356
ATCG00820 ATCG00820.1, RP... ribosomal protein S19 (.1) Potri.013G137688
[exp]
26.83 0.9349
AT5G25360 unknown protein Potri.018G027800
[exp]
27.12 0.8511
ATCG01300 ATCG01300.1, RP... ribosomal protein L23 (.1) Potri.013G138612
[exp]
27.69 0.9320
ATCG00820 ATCG00820.1, RP... ribosomal protein S19 (.1) Potri.011G074301
[exp]
29.79 0.9326
ATCG01300 ATCG01300.1, RP... ribosomal protein L23 (.1) Potri.005G154350
[exp]
32.31 0.9294

Potri.001G325900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.