Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G27030 79 / 1e-20 unknown protein AT5G40970 67 / 1e-16 Protein of unknown function (DUF 3339) (.1) AT3G48660 58 / 5e-13 Protein of unknown function (DUF 3339) (.1) AT5G63500 56 / 3e-12 Protein of unknown function (DUF 3339) (.1) AT5G08391 54 / 2e-11 Protein of unknown function (DUF 3339) (.1) AT3G01950 52 / 7e-11 Protein of unknown function (DUF 3339) (.1) AT5G14110 52 / 7e-11 Protein of unknown function (DUF 3339) (.1) AT3G27027 48 / 4e-09 Protein of unknown function (DUF 3339) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G064500 [exp] 85 / 1e-23 AT3G27030 111 / 2e-33 unknown protein Potri.015G098200 [exp] 65 / 2e-15 AT3G27030 107 / 7e-31 unknown protein Potri.003G170400 [exp] 57 / 9e-13 AT3G48660 89 / 3e-25 Protein of unknown function (DUF 3339) (.1) Potri.001G057900 [exp] 55 / 8e-12 AT5G08391 113 / 6e-35 Protein of unknown function (DUF 3339) (.1) Potri.003G170500 [exp] 54 / 1e-11 AT5G08391 112 / 9e-35 Protein of unknown function (DUF 3339) (.1) Potri.001G329000 [exp] 53 / 5e-11 AT5G08391 113 / 5e-35 Protein of unknown function (DUF 3339) (.1) Potri.017G064301 [exp] 52 / 8e-11 AT5G08391 108 / 5e-33 Protein of unknown function (DUF 3339) (.1) Potri.012G100100 [exp] 51 / 2e-10 AT5G63500 79 / 1e-21 Protein of unknown function (DUF 3339) (.1) Potri.017G065444 [exp] 50 / 3e-10 AT3G48660 67 / 2e-16 Protein of unknown function (DUF 3339) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041551 [exp] 84 / 4e-23 AT3G27030 113 / 3e-34 unknown protein Lus10012542 [exp] 84 / 4e-23 AT3G27030 113 / 3e-34 unknown protein Lus10035199 [exp] 82 / 2e-22 AT3G27030 108 / 4e-32 unknown protein Lus10032030 [exp] 80 / 7e-22 AT3G27030 106 / 2e-31 unknown protein Lus10032029 [exp] 80 / 5e-21 AT3G27027 106 / 4e-30 Protein of unknown function (DUF 3339) (.1) Lus10011353 [exp] 57 / 1e-12 AT3G48660 122 / 1e-38 Protein of unknown function (DUF 3339) (.1) Lus10015770 [exp] 56 / 5e-12 AT5G08391 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10037035 [exp] 55 / 6e-12 AT5G08391 111 / 2e-34 Protein of unknown function (DUF 3339) (.1) Lus10003120 [exp] 55 / 6e-12 AT3G48660 121 / 5e-38 Protein of unknown function (DUF 3339) (.1) Lus10037036 [exp] 55 / 6e-12 AT3G48660 112 / 3e-34 Protein of unknown function (DUF 3339) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11820 [poplar] [flax] DUF3339 Protein of unknown function (DUF3339)
Representative CDS sequence Show only first row Show all	>Potri.001G328800.3 pacid=42792495 polypeptide=Potri.001G328800.3.p locus=Potri.001G328800 ID=Potri.001G328800.3.v4.1 annot-version=v4.1 ATGGCAGACTGGGGGCCAGTGGTAATTGGGGTGGTGCTGTTTGTGTTGCTACAACCTGGTCTTTTGTTTCAGTTACCAGGAAACAACAAGCATGTGGATT TTGGGAGTTTGAAGACGAATGGAAAGGCTATAGCTGTTCATACTCTCATCTTTTTCACTGCCTATGCCATTCTCATCTTGGCTGTTCATGTTCACATCTA TACTGGCTGA
AA sequence Show only first row Show all	>Potri.001G328800.3 pacid=42792495 polypeptide=Potri.001G328800.3.p locus=Potri.001G328800 ID=Potri.001G328800.3.v4.1 annot-version=v4.1 MADWGPVVIGVVLFVLLQPGLLFQLPGNNKHVDFGSLKTNGKAIAVHTLIFFTAYAILILAVHVHIYTG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G27030			unknown protein		Potri.001G328800 [exp]	0	1
AT4G10850		SWEET7, AtSWEET...	Nodulin MtN3 family protein (....		Potri.003G143100 [exp]	5.29	0.9110
AT5G49120			Protein of unknown function (D...		Potri.008G219800 [exp]	5.65	0.9029
					Potri.008G031601 [exp]	5.65	0.9229
AT3G62290		ATARFA1E	ADP-ribosylation factor A1E (....		Potri.001G301200 [exp]	8.36	0.9294
AT4G35770		ATSEN1, DIN1, S...	SENESCENCE ASSOCIATED GENE 1, ...		Potri.002G014900 [exp]	11.13	0.9267
AT3G16360		AHP4	HPT phosphotransmitter 4 (.1.2...		Potri.018G046800 [exp]	12.08	0.8421
AT4G05430			Carbohydrate-binding X8 domain...		Potri.019G012000 [exp]	25.21	0.9225
AT1G06330			Heavy metal transport/detoxifi...		Potri.002G005300 [exp]	28.87	0.8456
AT2G16050			Cysteine/Histidine-rich C1 dom...		Potri.004G209200 [exp]	29.39	0.9164
AT1G32250			Calcium-binding EF-hand family...		Potri.014G030200 [exp]	29.66	0.9139

Compare expression of checked genes

Potri.001G328800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.