Potri.001G329200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G37530 392 / 2e-137 Peroxidase superfamily protein (.1.2)
AT5G14130 388 / 1e-135 Peroxidase superfamily protein (.1)
AT5G67400 386 / 6e-135 RHS19 root hair specific 19 (.1)
AT3G49960 379 / 3e-132 Peroxidase superfamily protein (.1)
AT4G30170 375 / 7e-131 Peroxidase family protein (.1)
AT4G37520 375 / 1e-130 Peroxidase superfamily protein (.1.2)
AT2G18980 371 / 4e-129 Peroxidase superfamily protein (.1)
AT4G17690 275 / 3e-91 Peroxidase superfamily protein (.1)
AT5G40150 263 / 1e-86 Peroxidase superfamily protein (.1)
AT5G47000 263 / 1e-86 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G064100 548 / 0 AT5G67400 372 / 2e-129 root hair specific 19 (.1)
Potri.018G089900 400 / 3e-140 AT4G30170 472 / 6e-169 Peroxidase family protein (.1)
Potri.007G053400 390 / 3e-136 AT5G67400 471 / 4e-168 root hair specific 19 (.1)
Potri.007G074700 293 / 2e-98 AT5G47000 358 / 8e-124 Peroxidase superfamily protein (.1)
Potri.012G076500 268 / 2e-88 AT4G17690 423 / 1e-149 Peroxidase superfamily protein (.1)
Potri.001G351000 266 / 1e-87 AT3G28200 448 / 2e-159 Peroxidase superfamily protein (.1)
Potri.010G036100 263 / 2e-86 AT1G24110 400 / 2e-140 Peroxidase superfamily protein (.1)
Potri.004G052100 261 / 1e-85 AT2G34060 458 / 1e-162 Peroxidase superfamily protein (.1)
Potri.005G108900 259 / 3e-85 AT5G42180 442 / 2e-157 peroxidase 64, Peroxidase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012540 449 / 2e-159 AT5G14130 384 / 5e-134 Peroxidase superfamily protein (.1)
Lus10032035 436 / 2e-154 AT5G67400 394 / 3e-138 root hair specific 19 (.1)
Lus10011079 386 / 1e-134 AT4G37530 479 / 2e-171 Peroxidase superfamily protein (.1.2)
Lus10001442 377 / 3e-131 AT4G30170 475 / 7e-170 Peroxidase family protein (.1)
Lus10035204 318 / 1e-108 AT5G67400 270 / 5e-90 root hair specific 19 (.1)
Lus10010716 275 / 4e-91 AT1G24110 407 / 4e-143 Peroxidase superfamily protein (.1)
Lus10039445 263 / 1e-86 AT5G40150 467 / 8e-167 Peroxidase superfamily protein (.1)
Lus10027163 256 / 8e-84 AT4G11290 491 / 4e-176 Peroxidase superfamily protein (.1)
Lus10013955 259 / 1e-83 AT2G34060 451 / 1e-158 Peroxidase superfamily protein (.1)
Lus10027405 253 / 2e-82 AT5G51890 448 / 2e-159 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Potri.001G329200.1 pacid=42789300 polypeptide=Potri.001G329200.1.p locus=Potri.001G329200 ID=Potri.001G329200.1.v4.1 annot-version=v4.1
ATGGAGAGAGGACGTTGCATGCTCTTGCTGATGATGGTTTTGATCATGGACATAGGTAGGGGAGAGGGACAGCTAGTAGAAGACTTCTACAGCTTTACTT
GTCCTAACGTGGAAGCTCTAGTGAAGAAGGCAGTTTCCACAAAGTTTAACCAGACATTCACTACAATCCCAGCAACTCTTCGTCTGTTTTTTCATGATTG
CTTTGTTACGGGTTGTGATGCTTCAACAATGGTTTCTTCACCAAATGGAGACGCAGAGAAGGATGCTCCAGATAATCTCTCTCTGGCAGGGGATGGATTT
GATACAGTAGTGAAGGCAAAGCAAAAAGTCGAAGGAGCTTGCCCCGGAGTAGTCTCCTGTGCAGACATTTTGGCTATAGCTGCTAGGGATGTCGTAGTCC
TGGCTGGAGGTCCTTCATTCAATGTAGAATTAGGACGTCGTGATGGCCTGGTTTCAAAAGCATCACTTGTGAAAGGAAACTTGCCAGAACCTGGCTTCAA
TCTTTCTCAACTTAACGCTATGTTTGCGAGAAACAACCTTAGCCAGATTGATATGATTGCACTATCAGGAGCCCACACGCTAGGCTTCTCTCATTGCAGC
CGCTTTGCGAATCGGCTCTACTCATTCTCCTCGTCCTCTCCTGTTGACCCTTCTCTAAATCAAGATTATGCCAAGCAGTTGATGGATGGATGTCCTAGAA
ATGTAGACCCCAGCATAGCCATTAACATGGACCCTGTAACCCCACAAACCTTTGACAATGTGTATTTCCAGAATTTGGTTAATGGTAAGGGATTGTTCAC
TTCAGATGAGGTGCTGTTTACGGATCCAGCTTCCCAGCCAACTGTCAAAGATTTTGCTAATAGCTCGAGCGATTTTAATGGAGCTTTTGCCACTGCCATG
AGAAAGCTTGGAAGGGTGCGAGTTAAGACAGGTAGCCAAGGAAGTATCAGGACAGACTGTACAGTCATTAATTCATGA
AA sequence
>Potri.001G329200.1 pacid=42789300 polypeptide=Potri.001G329200.1.p locus=Potri.001G329200 ID=Potri.001G329200.1.v4.1 annot-version=v4.1
MERGRCMLLLMMVLIMDIGRGEGQLVEDFYSFTCPNVEALVKKAVSTKFNQTFTTIPATLRLFFHDCFVTGCDASTMVSSPNGDAEKDAPDNLSLAGDGF
DTVVKAKQKVEGACPGVVSCADILAIAARDVVVLAGGPSFNVELGRRDGLVSKASLVKGNLPEPGFNLSQLNAMFARNNLSQIDMIALSGAHTLGFSHCS
RFANRLYSFSSSSPVDPSLNQDYAKQLMDGCPRNVDPSIAINMDPVTPQTFDNVYFQNLVNGKGLFTSDEVLFTDPASQPTVKDFANSSSDFNGAFATAM
RKLGRVRVKTGSQGSIRTDCTVINS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G37530 Peroxidase superfamily protein... Potri.001G329200 0 1
AT5G22900 ATCHX3 cation/H+ exchanger 3, ARABIDO... Potri.006G176800 1.41 0.9275
AT5G26594 ARR24 response regulator 24 (.1) Potri.002G253000 3.16 0.8842
AT5G57970 DNA glycosylase superfamily pr... Potri.001G044402 4.24 0.8975
AT3G49120 PRX34, PRXCB, A... PEROXIDASE 34, ARABIDOPSIS THA... Potri.001G013000 5.29 0.8560
AT1G32928 unknown protein Potri.011G151600 5.29 0.8186
Potri.006G037801 5.47 0.8817
AT5G06730 Peroxidase superfamily protein... Potri.001G012901 5.65 0.8454
AT2G35215 unknown protein Potri.001G142250 6.00 0.8429
AT5G24580 Heavy metal transport/detoxifi... Potri.015G003900 7.41 0.8251
AT1G21460 SWEET1, AtSWEET... Nodulin MtN3 family protein (.... Potri.002G072800 7.93 0.7899

Potri.001G329200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.