Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G50460 99 / 2e-29 secE/sec61-gamma protein transport protein (.1) AT4G24920 99 / 2e-29 secE/sec61-gamma protein transport protein (.1) AT3G48570 95 / 1e-27 secE/sec61-gamma protein transport protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G098400 [exp] 100 / 1e-29 AT5G50460 104 / 2e-31 secE/sec61-gamma protein transport protein (.1) Potri.015G097300 [exp] 99 / 1e-29 AT5G50460 103 / 3e-31 secE/sec61-gamma protein transport protein (.1) Potri.017G064032 [exp] 84 / 2e-23 AT5G50460 101 / 4e-30 secE/sec61-gamma protein transport protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035206 [exp] 102 / 1e-30 AT5G50460 127 / 1e-40 secE/sec61-gamma protein transport protein (.1) Lus10041552 [exp] 102 / 2e-30 AT5G50460 127 / 4e-40 secE/sec61-gamma protein transport protein (.1) Lus10012539 [exp] 102 / 2e-30 AT5G50460 127 / 4e-40 secE/sec61-gamma protein transport protein (.1) Lus10019065 [exp] 58 / 7e-13 AT4G31985 100 / 2e-29 Ribosomal protein L39 family protein (.1) Lus10032037 [exp] 0 / 1 AT3G48560 96 / 3e-23 TRIAZOLOPYRIMIDINE RESISTANT 5, IMIDAZOLE RESISTANT 1, ACETOLACTATE SYNTHASE, ACETOHYDROXY ACID SYNTHASE, chlorsulfuron/imidazolinone resistant 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00584 [poplar] [flax] SecE SecE/Sec61-gamma subunits of protein translocation complex
Representative CDS sequence Show only first row Show all	>Potri.001G329400.1 pacid=42792747 polypeptide=Potri.001G329400.1.p locus=Potri.001G329400 ID=Potri.001G329400.1.v4.1 annot-version=v4.1 ATGGACGCCATCGATTCAGTATTCGATCCATTGAGAGAGTTCTCTAAGGACAGCGTTCGCCTCGTCAAGCGCTGCCACAAGCCCGATCGCAAAGAGTTCA CGAAGGTGGCTTTCCGTACAGCGATAGGATTCGTAGTGATGGGATTCGTAGGTTTCTTTGTGAAACTCATATTTATTCCCATCAACAACATCATTGTCGG ATCCGTTTAG
AA sequence Show only first row Show all	>Potri.001G329400.1 pacid=42792747 polypeptide=Potri.001G329400.1.p locus=Potri.001G329400 ID=Potri.001G329400.1.v4.1 annot-version=v4.1 MDAIDSVFDPLREFSKDSVRLVKRCHKPDRKEFTKVAFRTAIGFVVMGFVGFFVKLIFIPINNIIVGSV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G50460			secE/sec61-gamma protein trans...		Potri.001G329400 [exp]	0	1
AT2G47320			Cyclophilin-like peptidyl-prol...		Potri.002G194250 [exp]	2.00	0.9554
AT1G12310			Calcium-binding EF-hand family...		Potri.001G117900 [exp]	2.82	0.9391
AT1G26355		SP1L1	SPIRAL1-like1 (.1)		Potri.008G097000 [exp]	2.82	0.9422
AT3G01390		AVMA10, VMA10	vacuolar membrane ATPase 10 (....		Potri.010G222000 [exp]	3.16	0.9411	VMA10.2
AT1G67785			unknown protein		Potri.015G087301 [exp]	3.60	0.9272
AT5G15320			unknown protein		Potri.002G024900 [exp]	4.58	0.9482
AT2G32580			Protein of unknown function (D...		Potri.014G155600 [exp]	6.48	0.9407
AT1G49140			Complex I subunit NDUFS6 (.1)		Potri.012G056900 [exp]	7.07	0.9360
AT1G19910		AVA-2PE, ATVHA-...	VACUOLAR-TYPE H+ ATPASE C2, AT...		Potri.005G235300 [exp]	8.24	0.9233
AT3G12587			Oligosaccaryltransferase (.1)		Potri.010G207100 [exp]	9.16	0.9083

Compare expression of checked genes

Potri.001G329400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.