GHS1.1 (Potri.001G331600) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol GHS1.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G27160 135 / 1e-40 GHS1 GLUCOSE HYPERSENSITIVE 1, Ribosomal protein S21 family protein (.1)
AT5G63300 79 / 1e-18 Ribosomal protein S21 family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G092700 98 / 1e-25 AT3G27160 79 / 2e-18 GLUCOSE HYPERSENSITIVE 1, Ribosomal protein S21 family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012528 118 / 6e-34 AT3G27160 140 / 2e-42 GLUCOSE HYPERSENSITIVE 1, Ribosomal protein S21 family protein (.1)
Lus10041564 116 / 3e-33 AT3G27160 140 / 8e-43 GLUCOSE HYPERSENSITIVE 1, Ribosomal protein S21 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01165 Ribosomal_S21 Ribosomal protein S21
Representative CDS sequence
>Potri.001G331600.7 pacid=42789550 polypeptide=Potri.001G331600.7.p locus=Potri.001G331600 ID=Potri.001G331600.7.v4.1 annot-version=v4.1
ATGGCTACCTCTTTATCTCTCCCAAACTTCCTCTCCTTCTTCTCACCTTCAAACCCACCTCCCAAAACCCCGGTGCCACCACCCCAACTCTCCTTTTCCA
CGCCGCAAGCTCAAAAGTACAAGTCTTTATTGTTTTCCCAAGAGAATGATGGTGGTCACTGTGGTTCTTTATCGACTGAATTGTCATCAGTTGTGTGCCC
TTCACTTGCTTATTCAAATACCCTTTTCTTTAAATCAGCATATAATGTGCAGGTCGTTGTGGAAGATAATGAGCCTGAAGAGAGGTTGCTGAATAGGTTC
AGGAGAGAAGTCATGAGAGCTGGTGTTATTCAAGAGTGTAAGAGAAGGAGGTTTCATGAGAACAAACAAGAAGAGAAGAAACGTAAGGTCCGTGAAGCTC
ATAAGCGTAATCGAAGAAGGCGCCCCCAGATGAGAGGCCCATTCCAAAACAAGCCAGAAGCATCTCCAAGCAAGAAGAATGATGATGATGACGATAACTG
GGAAATGCCTGAAGGAGACGCTTCTTTTTGA
AA sequence
>Potri.001G331600.7 pacid=42789550 polypeptide=Potri.001G331600.7.p locus=Potri.001G331600 ID=Potri.001G331600.7.v4.1 annot-version=v4.1
MATSLSLPNFLSFFSPSNPPPKTPVPPPQLSFSTPQAQKYKSLLFSQENDGGHCGSLSTELSSVVCPSLAYSNTLFFKSAYNVQVVVEDNEPEERLLNRF
RREVMRAGVIQECKRRRFHENKQEEKKRKVREAHKRNRRRRPQMRGPFQNKPEASPSKKNDDDDDNWEMPEGDASF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G27160 GHS1 GLUCOSE HYPERSENSITIVE 1, Ribo... Potri.001G331600 0 1 GHS1.1
AT2G33450 Ribosomal L28 family (.1) Potri.008G169800 1.41 0.9802
AT1G49975 unknown protein Potri.001G292000 1.41 0.9857
AT3G04760 Pentatricopeptide repeat (PPR-... Potri.013G047000 3.00 0.9777
AT3G53470 unknown protein Potri.016G084000 6.00 0.9755
AT5G40950 RPL27 ribosomal protein large subuni... Potri.001G329500 7.74 0.9777 Pt-RPL27.5
AT3G54050 HCEF1 high cyclic electron flow 1 (.... Potri.016G109000 7.74 0.9645
AT3G56910 PSRP5 plastid-specific 50S ribosomal... Potri.016G027600 9.48 0.9671
AT3G26650 GAPA-1, GAPA GLYCERALDEHYDE 3-PHOSPHATE DEH... Potri.002G220566 10.24 0.9753
AT4G30950 FADC, SFD4, FAD... STEAROYL DESATURASE DEFICIENCY... Potri.006G185400 10.48 0.9470
AT5G66530 Galactose mutarotase-like supe... Potri.007G023200 10.72 0.9635

Potri.001G331600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.