Potri.001G333800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G47455 54 / 1e-10 unknown protein
AT4G17310 52 / 4e-10 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G068600 82 / 1e-21 AT4G17310 94 / 2e-26 unknown protein
Potri.006G237800 37 / 0.0002 AT5G11630 99 / 8e-29 unknown protein
Potri.018G082800 37 / 0.0003 AT3G13674 / unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028954 46 / 1e-07 AT4G17310 100 / 5e-29 unknown protein
Lus10007477 44 / 6e-07 AT4G17310 95 / 6e-27 unknown protein
PFAM info
Representative CDS sequence
>Potri.001G333800.7 pacid=42793436 polypeptide=Potri.001G333800.7.p locus=Potri.001G333800 ID=Potri.001G333800.7.v4.1 annot-version=v4.1
ATGGCTTTCTCCTCATCTTGCAGGAGATTTATCTCCAAATCATCTCTATCGTCCATCAAATCAGCCATCAGGTCATCCAACGTTCCTAAATCTCCCTCCA
TGCCCACCAGATCTGCTACTGCTCTCCCATCATCCAAACCACCAACCTCCCCTCAATTCTCCTTTTCCAGGGCTCCATGTGAGTTGGGATGCGTTCAGTC
GCTGCTGCCACTACACAGCGCGGTGGCGGCGTCGAGGATGACATCATGCTTAAGCACTACATCCAGGAGTTGCCGTGCGCTCTCTCAGGGTACACTCTGC
TGCACTCTTTTATTGCTTCTCTAG
AA sequence
>Potri.001G333800.7 pacid=42793436 polypeptide=Potri.001G333800.7.p locus=Potri.001G333800 ID=Potri.001G333800.7.v4.1 annot-version=v4.1
MAFSSSCRRFISKSSLSSIKSAIRSSNVPKSPSMPTRSATALPSSKPPTSPQFSFSRAPCELGCVQSLLPLHSAVAASRMTSCLSTTSRSCRALSQGTLC
CTLLLLL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G47455 unknown protein Potri.001G333800 0 1
AT1G28395 unknown protein Potri.011G057300 2.23 0.8856
AT2G45860 unknown protein Potri.002G158300 3.87 0.8588
AT4G11060 MTSSB mitochondrially targeted singl... Potri.013G011800 4.00 0.8465
AT5G40770 ATPHB3 prohibitin 3 (.1) Potri.017G065800 6.92 0.8591 PHB3.1
AT4G23620 Ribosomal protein L25/Gln-tRNA... Potri.001G097801 6.92 0.8201
AT1G18800 NRP2 NAP1-related protein 2 (.1) Potri.015G062700 8.06 0.7902
AT3G51010 unknown protein Potri.007G018300 10.90 0.7819
AT1G79650 AtAO1, RAD23B, ... RADIATION SENSITIVE23B, Arabid... Potri.001G038000 11.22 0.7699 RAD23.1
AT3G52040 unknown protein Potri.001G262000 15.87 0.7896
AT1G47278 unknown protein Potri.009G029400 17.32 0.7634

Potri.001G333800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.