Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G14360 166 / 6e-53 Ubiquitin-like superfamily protein (.1) AT5G40630 141 / 2e-43 Ubiquitin-like superfamily protein (.1) AT5G62100 96 / 5e-25 ATBAG2 BCL-2-associated athanogene 2 (.1.2.3) AT5G07220 91 / 2e-22 ATBAG3 BCL-2-associated athanogene 3 (.1) AT5G52060 82 / 6e-19 ATBAG1 BCL-2-associated athanogene 1 (.1) AT3G51780 77 / 3e-17 ATBAG4 BCL-2-associated athanogene 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G074300 [exp] 135 / 1e-39 AT3G51780 196 / 4e-62 BCL-2-associated athanogene 4 (.1) Potri.001G279500 [exp] 129 / 2e-37 AT3G51780 210 / 2e-67 BCL-2-associated athanogene 4 (.1) Potri.001G358200 [exp] 90 / 2e-22 AT5G07220 207 / 9e-66 BCL-2-associated athanogene 3 (.1) Potri.015G135500 [exp] 90 / 1e-21 AT5G52060 303 / 2e-101 BCL-2-associated athanogene 1 (.1) Potri.003G121500 [exp] 89 / 1e-21 AT5G52060 243 / 1e-78 BCL-2-associated athanogene 1 (.1) Potri.012G133400 [exp] 87 / 1e-20 AT5G52060 305 / 2e-102 BCL-2-associated athanogene 1 (.1) Potri.001G110300 [exp] 86 / 4e-20 AT5G52060 239 / 2e-76 BCL-2-associated athanogene 1 (.1) Potri.016G121200 [exp] 62 / 4e-12 AT3G51780 218 / 1e-70 BCL-2-associated athanogene 4 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022315 [exp] 164 / 9e-52 AT5G14360 158 / 2e-49 Ubiquitin-like superfamily protein (.1) Lus10014884 [exp] 159 / 6e-50 AT5G14360 158 / 2e-49 Ubiquitin-like superfamily protein (.1) Lus10032107 [exp] 148 / 1e-45 AT5G40630 136 / 4e-41 Ubiquitin-like superfamily protein (.1) Lus10027420 [exp] 97 / 3e-24 AT5G52060 349 / 6e-120 BCL-2-associated athanogene 1 (.1) Lus10027822 [exp] 93 / 4e-23 AT3G51780 221 / 4e-71 BCL-2-associated athanogene 4 (.1) Lus10023279 [exp] 91 / 6e-23 AT5G07220 196 / 4e-62 BCL-2-associated athanogene 3 (.1) Lus10005051 [exp] 94 / 7e-23 AT3G51780 221 / 1e-69 BCL-2-associated athanogene 4 (.1) Lus10038882 [exp] 86 / 3e-20 AT5G52060 327 / 1e-111 BCL-2-associated athanogene 1 (.1) Lus10015004 [exp] 84 / 7e-20 AT5G52060 333 / 4e-114 BCL-2-associated athanogene 1 (.1) Lus10006328 [exp] 81 / 8e-19 AT5G52060 194 / 2e-60 BCL-2-associated athanogene 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [poplar] [flax] Ubiquitin PF00240 [poplar] [flax] ubiquitin Ubiquitin family
Representative CDS sequence Show only first row Show all	>Potri.001G339100.2 pacid=42788614 polypeptide=Potri.001G339100.2.p locus=Potri.001G339100 ID=Potri.001G339100.2.v4.1 annot-version=v4.1 ATGATCAAGCTGAGGTCAAAGAGGTTTTGCAGAGGCAGCTTTAAACTTGGTGGTAATGGTGGCGGTGGAGGCAACACTGCTGTCAAAGGAAATGAAAGAG GGTCCTGTGGAGGCACTAATAATGGTGAAATCAAATGGGAGCTTAGGCCTGGTGGCATGCTTGTTCAAAAGAGAGAAAGTGGAGAGAGTGTTGGAGAGTT AATCACAGTGAGGGTCTCAACTGTTTCACAATGGCATGACATCTCCATTGAAGCAACTTCAACCTTCGAGGAATTGAAGATGGTATTGTCATTGGTAACT AGCTTGGAGCCAAAAGAACAAAGGCTACTGTTCAAAGGAAAGGAGAGAGACAACAGTGAATACTTACACATGGTTGGGGTTAGAGACAAGGACAAGGTGC TCTTGTTGGAAGATCCAGCTATCAAGGAAAGGAAGCTTCATGGCTTGGCAGGAGGCCAAGCCATTGGGACTCCTTGTCGTACCATAAGTGTATAA
AA sequence Show only first row Show all	>Potri.001G339100.2 pacid=42788614 polypeptide=Potri.001G339100.2.p locus=Potri.001G339100 ID=Potri.001G339100.2.v4.1 annot-version=v4.1 MIKLRSKRFCRGSFKLGGNGGGGGNTAVKGNERGSCGGTNNGEIKWELRPGGMLVQKRESGESVGELITVRVSTVSQWHDISIEATSTFEELKMVLSLVT SLEPKEQRLLFKGKERDNSEYLHMVGVRDKDKVLLLEDPAIKERKLHGLAGGQAIGTPCRTISV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G14360			Ubiquitin-like superfamily pro...		Potri.001G339100 [exp]	0	1
AT4G14650			unknown protein		Potri.010G081000 [exp]	1.00	0.8030
AT5G62090		SLK2	SEUSS-like 2 (.1.2)		Potri.003G121800 [exp]	24.49	0.6663
AT3G05980			unknown protein		Potri.008G150300 [exp]	27.64	0.7567
AT3G46540			ENTH/VHS family protein (.1)		Potri.009G030500 [exp]	37.22	0.6919
AT5G62170			unknown protein		Potri.012G132900 [exp]	44.07	0.6902
AT4G30200		VEL1, VIL2	VIN3-Like 2, vernalization5/VI...		Potri.018G091500 [exp]	45.51	0.6444
AT4G24350			Phosphorylase superfamily prot...		Potri.008G028700 [exp]	54.68	0.7146
AT4G22730			Leucine-rich repeat protein ki...		Potri.001G117800 [exp]	58.86	0.7082
AT5G23720		PHS1	PROPYZAMIDE-HYPERSENSITIVE 1, ...		Potri.012G105800 [exp]	59.68	0.6713	Pt-PHS1.1
AT1G55210			Disease resistance-responsive ...		Potri.003G216300 [exp]	67.10	0.6486

Compare expression of checked genes

Potri.001G339100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.