Plant FIBer expression Database

Potri.001G339700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.001G339700.1 pacid=42793008 polypeptide=Potri.001G339700.1.p locus=Potri.001G339700 ID=Potri.001G339700.1.v4.1 annot-version=v4.1
ATGGCACGCCAAGTTCTTGCTCTTGCACTCATCTTTGTTGCCGTTGTTGGGGCATTTGCTGCTGAGGCACCTTCCGCCACCCCTTTGGCTTCACCGTCAC
CAAAGGCCTCTGTGGCTCCCGCTAAGGCACCCACAGCCGATACCCCAAAGGCATCGGCCAGCGCCCCCGCCATCTCTGGAGCCCCGAATGGCTCTGCCTC
CTCACCTGTTGCCGAAGAGGGCCCCGCTGGAGCCCCAGAAGAGGAAATCTCTTCACCTCCTGCCCCAGCCAGCCTTAGCGCAGAAGGACCTGCAGGACCT
GCTGCTGGACCAATAGCCGATGTTGTCAGCGATGCACCAGCCACACCACCAGCACCCCAGAAAGACGGAGCTGCCACTATCAAGATCTCTACAGCTGCCG
TTGTCGCTGGCCTATTGGTCTTCTTATCCTTCTAA
AA sequence
>Potri.001G339700.1 pacid=42793008 polypeptide=Potri.001G339700.1.p locus=Potri.001G339700 ID=Potri.001G339700.1.v4.1 annot-version=v4.1
MARQVLALALIFVAVVGAFAAEAPSATPLASPSPKASVAPAKAPTADTPKASASAPAISGAPNGSASSPVAEEGPAGAPEEEISSPPAPASLSAEGPAGP
AAGPIADVVSDAPATPPAPQKDGAATIKISTAAVVAGLLVFLSF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G339700
[exp]
0 1
AT5G14010 C2H2ZnF KNUCKLES, KNU KNUCKLES, C2H2 and C2HC zinc f... Potri.001G324600
[exp]
5.56 0.7204
Potri.014G104750
[exp]
10.58 0.7109
Potri.006G122650
[exp]
11.61 0.7001
AT2G17570 Undecaprenyl pyrophosphate syn... Potri.002G039400
[exp]
18.57 0.6963
Potri.014G151351
[exp]
22.80 0.6021
AT1G15190 Fasciclin-like arabinogalactan... Potri.001G306800
[exp]
25.92 0.6919
AT2G02800 Kin2, APK2B protein kinase 2B (.1.2) Potri.006G066150
[exp]
26.68 0.6861
AT3G09510 Ribonuclease H-like superfamil... Potri.004G015067
[exp]
27.38 0.6667
AT4G02810 FAF1 FANTASTIC FOUR 1, Protein of u... Potri.002G053400
[exp]
31.60 0.6728
AT2G15490 UGT73B4 UDP-glycosyltransferase 73B4 (... Potri.005G036100
[exp]
31.96 0.5129

Potri.001G339700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.