Plant FIBer expression Database

Potri.001G340100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF08213 DUF1713 Mitochondrial domain of unknown function (DUF1713)
Representative CDS sequence
>Potri.001G340100.1 pacid=42791830 polypeptide=Potri.001G340100.1.p locus=Potri.001G340100 ID=Potri.001G340100.1.v4.1 annot-version=v4.1
ATGGCACTATCAACTCTTCAACAACTCCTCAAAAAATCGCCACTACATTCAAGAATCCTTGCTTCGCTTCAAAACCCTCATTTGCTTCAATCCCCGAAAG
TAAATCCACCCGTCAATATCGATGGCAGACCATTTTTGTTTGGTTCATCTAAAGTAGAAAACTTGACCCATTTGAATCCCTGGCTATTTTCACCGATATC
TCCAGTTCAGATATTTTCTTACCAGAATTTATCATCTGGGTCGGCCCAAGATGGTTCAAACGATGATGATTCAGGGATGTGGGCTGATAGTGTGAAGAAG
AAGAGAAAGAAGAAGATGAACAAGCATAAGTACAGAAAGTTGAAGAAAAGGCTTAGGAGACGGACTTAG
AA sequence
>Potri.001G340100.1 pacid=42791830 polypeptide=Potri.001G340100.1.p locus=Potri.001G340100 ID=Potri.001G340100.1.v4.1 annot-version=v4.1
MALSTLQQLLKKSPLHSRILASLQNPHLLQSPKVNPPVNIDGRPFLFGSSKVENLTHLNPWLFSPISPVQIFSYQNLSSGSAQDGSNDDDSGMWADSVKK
KRKKKMNKHKYRKLKKRLRRRT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G340100
[exp]
0 1
AT3G09890 Ankyrin repeat family protein ... Potri.006G121500
[exp]
1.00 0.8854
AT3G59280 TXR1 THAXTOMIN A RESISTANT 1, Prote... Potri.012G108600
[exp]
1.41 0.8605
AT2G35795 Chaperone DnaJ-domain superfam... Potri.006G131200
[exp]
2.00 0.8573
AT2G46390 SDH8 succinate dehydrogenase 8, unk... Potri.014G095901
[exp]
3.60 0.8120
AT3G04610 FLK flowering locus KH domain, RNA... Potri.013G043000
[exp]
3.74 0.8088
AT3G17910 EMB3121, SURF1 SURFEIT 1, EMBRYO DEFECTIVE 31... Potri.012G045200
[exp]
4.00 0.7966
AT2G26990 COP12, ATCSN2, ... FUSCA 12, CONSTITUTIVE PHOTOMO... Potri.001G222700
[exp]
4.24 0.7864 FUS12.2
AT3G62810 complex 1 family protein / LVR... Potri.014G129800
[exp]
4.47 0.8199
AT4G39880 Ribosomal protein L23/L15e fam... Potri.007G093100
[exp]
4.79 0.7758
AT5G55140 ribosomal protein L30 family p... Potri.014G157400
[exp]
5.19 0.8578

Potri.001G340100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.