Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G14410 67 / 4e-15 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022295 [exp] 76 / 3e-18 AT5G14410 59 / 4e-12 unknown protein Lus10003654 [exp] 78 / 1e-17 AT3G01650 376 / 2e-127 RING domain ligase1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G342100.1 pacid=42793017 polypeptide=Potri.001G342100.1.p locus=Potri.001G342100 ID=Potri.001G342100.1.v4.1 annot-version=v4.1 ATGGCCAAGGGCCCCAAGTTTCCTTACCACAAACTGAAGCATGAAGGTTTCTGTGATGAATATGAAGAGAGGCAGAGATTCAATATTGTCAAATCAAGAA GGTGGTACGGGTTCAGGAGGGTGCATATAAGAAAGAGGTTTAGGCTCAAGGTTCCAAGCTTGGGGAGATTCTTGAGGAGGAGAGTTAAGCTGGTCTCTGC CGTTAGGCTTTCGTGTGCCAAGGTGCTGAAGAGATTGAAGGAAGGTCAGGCTCATTTTGGTGATCTTTTTGCAGGGAACTATCTGTTCATGCAGGTCAAT CCCACTCCATTGAAGTACTTCGAGAGATCTTATTATAATAATAATGTCCTTGACCTTAACAGCTTTCCTCCGGGCTACTGCTCTCTTCCAAGAATTGCTC ATTGA
AA sequence Show only first row Show all	>Potri.001G342100.1 pacid=42793017 polypeptide=Potri.001G342100.1.p locus=Potri.001G342100 ID=Potri.001G342100.1.v4.1 annot-version=v4.1 MAKGPKFPYHKLKHEGFCDEYEERQRFNIVKSRRWYGFRRVHIRKRFRLKVPSLGRFLRRRVKLVSAVRLSCAKVLKRLKEGQAHFGDLFAGNYLFMQVN PTPLKYFERSYYNNNVLDLNSFPPGYCSLPRIAH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G14410			unknown protein		Potri.001G342100 [exp]	0	1
					Potri.001G021300 [exp]	1.41	0.9655
AT2G18350	ZF_HD	ATHB24, ZHD6	ZINC FINGER HOMEODOMAIN 6, hom...		Potri.005G227900 [exp]	1.41	0.9726
AT5G65207			unknown protein		Potri.005G081400 [exp]	2.00	0.9614
AT3G60120		BGLU27	beta glucosidase 27 (.1)		Potri.005G059500 [exp]	3.00	0.9615
AT4G04890	HD	PDF2	protodermal factor 2 (.1)		Potri.004G020400 [exp]	3.16	0.9365	ATML1.2
AT3G18080		BGLU44	B-S glucosidase 44 (.1)		Potri.015G041300 [exp]	4.24	0.9524
AT1G07650			Leucine-rich repeat transmembr...		Potri.011G073316 [exp]	4.47	0.9210
AT1G14440	ZF_HD	ATHB31, ZHD4	ZINC FINGER HOMEODOMAIN 4, hom...		Potri.002G035200 [exp]	5.91	0.9582
AT1G03670			ankyrin repeat family protein ...		Potri.019G101500 [exp]	8.94	0.9502
AT3G01680		SEOR1, SEOb	Sieve-Element-Occlusion-Relate...		Potri.010G050300 [exp]	10.81	0.9297

Compare expression of checked genes

Potri.001G342100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.