Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RPL27.3
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G15000 210 / 2e-71 Ribosomal L27e protein family (.1.2) AT3G22230 207 / 2e-70 Ribosomal L27e protein family (.1) AT2G32220 194 / 6e-65 Ribosomal L27e protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G019000 [exp] 225 / 2e-77 AT4G15000 209 / 5e-71 Ribosomal L27e protein family (.1.2) Potri.006G021500 [exp] 221 / 1e-75 AT4G15000 205 / 2e-69 Ribosomal L27e protein family (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003814 [exp] 207 / 3e-70 AT4G15000 239 / 7e-83 Ribosomal L27e protein family (.1.2) Lus10010461 [exp] 205 / 3e-69 AT4G15000 236 / 7e-82 Ribosomal L27e protein family (.1.2) Lus10027314 [exp] 204 / 3e-69 AT4G15000 233 / 2e-80 Ribosomal L27e protein family (.1.2) Lus10039017 [exp] 202 / 5e-68 AT4G15000 232 / 3e-80 Ribosomal L27e protein family (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01777 [poplar] [flax] Ribosomal_L27e Ribosomal L27e protein family
Representative CDS sequence Show only first row Show all	>Potri.001G342500.1 pacid=42788318 polypeptide=Potri.001G342500.1.p locus=Potri.001G342500 ID=Potri.001G342500.1.v4.1 annot-version=v4.1 ATGGTGAAGTTCTTGAAGACAAACAAGGCCGTCATAATCCTGCAAGGAAAATATGCAGGTCGCAAAGGAGTAATCGTCAGGTCCTTCGACGATGGTACAC GTGATCGCCCGTACGGCCACTGTTTGGTTGCAGGGATTAAGAAGTACCCAAGCAAGGTTATCAAGAAGGACTCAGCCAAAAAGACTGCCAAGAAATCCCG GGTCAAGTGCTTCATCAAGCTAGTGAACTACCAGCACCTGATGCCCACACGTTACACGCTGGATGTGGACTTGAAAGATGTTGTGACCGCTGATTGTTTG TCAACCAAGGATAAGAAGATTACTGCTTGCAAGGAGACAAAGGCTAGGTTCGAGGAGCGGTTTAAGACAGGCAAGAACAGGTGGTTTTTTACAAAGCTGA GGTTTTGA
AA sequence Show only first row Show all	>Potri.001G342500.1 pacid=42788318 polypeptide=Potri.001G342500.1.p locus=Potri.001G342500 ID=Potri.001G342500.1.v4.1 annot-version=v4.1 MVKFLKTNKAVIILQGKYAGRKGVIVRSFDDGTRDRPYGHCLVAGIKKYPSKVIKKDSAKKTAKKSRVKCFIKLVNYQHLMPTRYTLDVDLKDVVTADCL STKDKKITACKETKARFEERFKTGKNRWFFTKLRF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G15000			Ribosomal L27e protein family ...		Potri.001G342500 [exp]	0	1	RPL27.3
AT2G37190			Ribosomal protein L11 family p...		Potri.018G146600 [exp]	2.44	0.9483	RPL12.2
AT3G05560			Ribosomal L22e protein family ...		Potri.002G204100 [exp]	3.74	0.9300	RPL22.4
AT1G20430			unknown protein		Potri.002G013601 [exp]	4.12	0.9261
AT4G39200			Ribosomal protein S25 family p...		Potri.004G157200 [exp]	4.89	0.9177
AT1G74050			Ribosomal protein L6 family pr...		Potri.001G271500 [exp]	5.74	0.9412
AT1G15250			Zinc-binding ribosomal protein...		Potri.006G243300 [exp]	9.38	0.9334
AT1G18080		RACK1A_AT, ATAR...	RECEPTOR FOR ACTIVATED C KINAS...		Potri.012G052700 [exp]	10.95	0.9404	Pt-GBF1.3
AT2G18110			Translation elongation factor...		Potri.015G094200 [exp]	11.48	0.9307	Pt-EEF1.1
AT3G11940		AML1, ATRPS5A	ARABIDOPSIS MINUTE-LIKE 1, rib...		Potri.006G197700 [exp]	11.48	0.9404	RPS5.2
AT2G41840			Ribosomal protein S5 family pr...		Potri.016G055000 [exp]	12.64	0.9352	Pt-RPS2.3

Compare expression of checked genes

Potri.001G342500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.