Potri.001G345900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G14530 556 / 0 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G66240 320 / 2e-108 Transducin/WD40 repeat-like superfamily protein (.1.2.3)
AT4G02730 78 / 6e-16 AtWDR5b human WDR5 \(WD40 repeat\) homolog b, Transducin/WD40 repeat-like superfamily protein (.1)
AT3G49660 73 / 3e-14 AtWDR5a human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1)
AT5G50230 71 / 2e-13 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G08390 60 / 1e-09 Transducin/WD40 repeat-like superfamily protein (.1)
AT2G41500 59 / 2e-09 EMB2776, LIS LACHESIS, WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related (.1)
AT5G23430 58 / 4e-09 Transducin/WD40 repeat-like superfamily protein (.1.2)
AT3G27640 57 / 1e-08 Transducin/WD40 repeat-like superfamily protein (.1)
AT1G61210 57 / 1e-08 DWA3 DWD hypersensitive to ABA 3, Transducin/WD40 repeat-like superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G071900 667 / 0 AT5G14530 558 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.005G114600 328 / 7e-112 AT5G66240 556 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2.3)
Potri.002G051900 85 / 2e-18 AT4G02730 524 / 0.0 human WDR5 \(WD40 repeat\) homolog b, Transducin/WD40 repeat-like superfamily protein (.1)
Potri.005G148500 81 / 5e-17 AT3G49660 503 / 0.0 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1)
Potri.015G087200 71 / 2e-13 AT5G50230 801 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.007G009500 71 / 2e-13 AT3G49660 469 / 4e-168 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1)
Potri.008G002300 58 / 5e-09 AT5G08390 1006 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.010G255400 57 / 8e-09 AT5G08390 927 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.006G084600 56 / 2e-08 AT2G37670 920 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014558 627 / 0 AT5G14530 552 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10021575 334 / 5e-114 AT5G66240 540 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2.3)
Lus10017157 335 / 1e-112 AT5G66240 541 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2.3)
Lus10032128 291 / 2e-98 AT5G14530 260 / 8e-87 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10006916 84 / 3e-18 AT4G02730 506 / 0.0 human WDR5 \(WD40 repeat\) homolog b, Transducin/WD40 repeat-like superfamily protein (.1)
Lus10014674 83 / 8e-18 AT4G02730 508 / 0.0 human WDR5 \(WD40 repeat\) homolog b, Transducin/WD40 repeat-like superfamily protein (.1)
Lus10039636 72 / 5e-14 AT3G49660 502 / 0.0 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1)
Lus10003487 62 / 9e-11 AT3G49660 489 / 6e-176 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1)
Lus10004167 62 / 3e-10 AT2G41500 708 / 0.0 LACHESIS, WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related (.1)
Lus10018081 60 / 2e-09 AT5G50230 766 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0186 Beta_propeller PF00400 WD40 WD domain, G-beta repeat
Representative CDS sequence
>Potri.001G345900.2 pacid=42791271 polypeptide=Potri.001G345900.2.p locus=Potri.001G345900 ID=Potri.001G345900.2.v4.1 annot-version=v4.1
ATGGCTATGACGTCGCTTACAGAACTCGATGATGATACGGTGCGCAGCATGTCTGTTGGAGCTGTTTTCTCCGAATTTGGGGGGAAGATTAATTCAATTG
ATTTTCATCGAAAAGACGATTTGTTAGTTACAGCTAGCGAGGATGATTCGGTTCGCCTTTACGACATTGCAAGTGCCAAATTGCTGAAGACTACGTTTCA
CAAGAAACACGGTGCAGATCGAATATGTTTCACGCACCACCCTAGCTCTGTTATTTGTTCCTCAACATACAATTTAGATTCTACCGGAGAATCATTACGT
TATCTATCAATGTATGATAATCGATGTCTTCGCTACTTCAAAGGGCATAAAGAGAGGGTTGTTTCCCTCTGCATGTCTCCAATCAATGATAGCTTCATGT
CTGGTTCTCTTGATCACAGCGTTAGAATATGGGATCTTCGTGTAAATGCCTGCCAGGGAATTTTGCGTTTACGTGGTAGACCCACAGTTGCATATGACCA
ACAAGGTCTTGTCTTTGCTGTGGCAATGGAAGGGGGTGCTATTAAGCTGTTTGATTCACGTTCCTATGACAAGGGTCCCTTTGACACCTTTTTAGTTGGT
GGAGATACAGCTGAGGTCTGTGATATTAAATTCAGCAATGATGGCAAATCAATGCTATTGACGACCACAAGTAACAACATCTATGTTCTCGATGCATATG
GTGGAGAGAAGCGATGTGGGTTCAGTTTGGAACCATCTCCAAATACAAAAATAGAGGCAACTTTTACCCCAGATGGCCAATATGTGGTATCAGGCTCAGG
AGATGGAACCTTGCATGCCTGGAACATCAACATGCGAAATGAGGTATCATGCTGGAACAGTCACATAGGTATCGCATCATGCTTGAAATGGGCTCCTCGT
CGTGCCATGTTTGTTGCTGCGTCTACTGTTCTCACGTTTTGGATACCGGACAGCTCAAAATCAACTGTCGAACCTCGTCCCATGGACGTTGAAGGTGCAG
CAGCTCCATCTGAAAATGTATCTCAACAATGA
AA sequence
>Potri.001G345900.2 pacid=42791271 polypeptide=Potri.001G345900.2.p locus=Potri.001G345900 ID=Potri.001G345900.2.v4.1 annot-version=v4.1
MAMTSLTELDDDTVRSMSVGAVFSEFGGKINSIDFHRKDDLLVTASEDDSVRLYDIASAKLLKTTFHKKHGADRICFTHHPSSVICSSTYNLDSTGESLR
YLSMYDNRCLRYFKGHKERVVSLCMSPINDSFMSGSLDHSVRIWDLRVNACQGILRLRGRPTVAYDQQGLVFAVAMEGGAIKLFDSRSYDKGPFDTFLVG
GDTAEVCDIKFSNDGKSMLLTTTSNNIYVLDAYGGEKRCGFSLEPSPNTKIEATFTPDGQYVVSGSGDGTLHAWNINMRNEVSCWNSHIGIASCLKWAPR
RAMFVAASTVLTFWIPDSSKSTVEPRPMDVEGAAAPSENVSQQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G14530 Transducin/WD40 repeat-like su... Potri.001G345900 0 1
AT3G45020 Ribosomal L18p/L5e family prot... Potri.004G214400 12.00 0.7639
Potri.013G032950 17.54 0.7158
Potri.008G206733 23.74 0.7529
AT1G43770 RING/FYVE/PHD zinc finger supe... Potri.005G189400 27.38 0.6867
AT3G28370 unknown protein Potri.017G074100 28.67 0.7330
AT3G45740 hydrolase family protein / HAD... Potri.008G045700 36.00 0.7035
AT4G00850 GIF3 GRF1-interacting factor 3 (.1) Potri.002G177600 43.12 0.6450 Pt-GIF2.1
AT1G16650 S-adenosyl-L-methionine-depend... Potri.007G065300 44.54 0.6985
AT4G31860 Protein phosphatase 2C family ... Potri.003G183800 48.64 0.6631
AT1G59740 Major facilitator superfamily ... Potri.001G272900 50.10 0.7243

Potri.001G345900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.