Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-RPL12.6
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G27830 146 / 9e-45 RPL12-A ribosomal protein L12-A (.1) AT3G27850 141 / 1e-42 RPL12-C ribosomal protein L12-C (.1) AT3G27840 119 / 9e-34 RPL12-B ribosomal protein L12-B (.1) AT3G06040 54 / 3e-09 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3) AT4G36420 47 / 1e-06 Ribosomal protein L12 family protein (.1) AT1G70190 44 / 1e-05 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2) AT4G37660 42 / 5e-05 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G077200 [exp] 53 / 7e-09 AT3G06040 132 / 3e-39 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3) Potri.007G019100 [exp] 51 / 5e-08 AT4G36420 127 / 2e-37 Ribosomal protein L12 family protein (.1) Potri.004G224300 [exp] 44 / 1e-05 AT4G37660 154 / 4e-48 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1) Potri.003G074800 [exp] 43 / 3e-05 AT1G70190 204 / 1e-66 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013078 [exp] 140 / 3e-42 AT3G27830 175 / 7e-56 ribosomal protein L12-A (.1) Lus10022261 [exp] 140 / 4e-42 AT3G27850 178 / 4e-57 ribosomal protein L12-C (.1) Lus10031180 [exp] 53 / 9e-09 AT3G06040 202 / 2e-66 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3) Lus10031756 [exp] 53 / 1e-08 AT3G06040 202 / 2e-66 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3) Lus10028336 [exp] 50 / 9e-08 AT4G36420 176 / 1e-56 Ribosomal protein L12 family protein (.1) Lus10041783 [exp] 50 / 1e-07 AT4G36420 174 / 5e-56 Ribosomal protein L12 family protein (.1) Lus10000093 [exp] 49 / 2e-07 AT4G37660 155 / 1e-48 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1) Lus10023839 [exp] 49 / 2e-07 AT4G37660 155 / 1e-48 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1) Lus10021011 [exp] 49 / 3e-07 AT4G37660 157 / 3e-49 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1) Lus10036228 [exp] 46 / 3e-06 AT1G70190 238 / 3e-80 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00542 [poplar] [flax] Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain PF16320 [poplar] [flax] Ribosomal_L12_N Ribosomal protein L7/L12 dimerisation domain
Representative CDS sequence Show only first row Show all	>Potri.001G346100.1 pacid=42793203 polypeptide=Potri.001G346100.1.p locus=Potri.001G346100 ID=Potri.001G346100.1.v4.1 annot-version=v4.1 ATGGCAACAACAAACCCCCTCTCTACAACAATCCCAACACTCTCTCTCCACTCTCCATCGTCTTCCACCACACACTCCCCCACCAAACACTTCCTCCTCT TCCCTCGCCGCCAACTCCCCCTCTCTTTCCGCTCCTCCCACGTCCGCCCCGTCGCCGCCGTCGCCGCCCCTGAAAAAATCGAGAAACTCGGTGCAGAAAT CTCCTCCTTAACCCTCGAAGAAGCCCGCACCCTCGTCGACTACCTTCAGGACAAGCTCGGGGTTTCGGCTGCTGCATTTGCACCAGCAGCTGCCGTGGGT GTCGCGCCAGGGGCTGCAGCTGATGCGGGAGCAGCAGTGGTAGAAGAGAAGACGGAGTTCGATGTTGTTATTGAGGAAGTGCCCAGTAATGTTAGAATTG CGGTGATTAAATCGGTTAGGGCTTTGACCAGCTTGGCATTGAAGGAGGCCAAGGAATTGATTGAAGGATTGCCTAAGAAGTTTAAAGAAGGGGTTTCTAA AGATGAAGCTGAAGAGGCCAAGAAGCAACTTGAAGCGGCTGGTGCTAAATGTTCTGTTGTTTGA
AA sequence Show only first row Show all	>Potri.001G346100.1 pacid=42793203 polypeptide=Potri.001G346100.1.p locus=Potri.001G346100 ID=Potri.001G346100.1.v4.1 annot-version=v4.1 MATTNPLSTTIPTLSLHSPSSSTTHSPTKHFLLFPRRQLPLSFRSSHVRPVAAVAAPEKIEKLGAEISSLTLEEARTLVDYLQDKLGVSAAAFAPAAAVG VAPGAAADAGAAVVEEKTEFDVVIEEVPSNVRIAVIKSVRALTSLALKEAKELIEGLPKKFKEGVSKDEAEEAKKQLEAAGAKCSVV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G27830		RPL12-A	ribosomal protein L12-A (.1)		Potri.001G346100 [exp]	0	1	Pt-RPL12.6
AT5G54600			Translation protein SH3-like f...		Potri.001G415400 [exp]	1.00	0.9924
ATCG00900		ATCG00900.1, RP...	CHLOROPLAST RIBOSOMAL PROTEIN ...		Potri.004G140500 [exp]	1.41	0.9921
AT1G05190		EMB2394	embryo defective 2394, Ribosom...		Potri.014G153000 [exp]	1.73	0.9915
AT5G14910			Heavy metal transport/detoxifi...		Potri.001G350500 [exp]	3.46	0.9871
AT1G79850		PDE347, CS17, P...	PLASTID RIBOSOMAL SMALL SUBUNI...		Potri.001G184000 [exp]	3.87	0.9876
AT1G14345			NAD(P)-linked oxidoreductase s...		Potri.010G093300 [exp]	4.24	0.9857
AT4G20360		AtRab8D, AtRABE...	RAB GTPase homolog E1B (.1)		Potri.003G121600 [exp]	4.89	0.9876
AT1G78630		EMB1473	embryo defective 1473, Ribosom...		Potri.001G384600 [exp]	4.89	0.9858
AT3G52150			RNA-binding (RRM/RBD/RNP motif...		Potri.009G065900 [exp]	6.48	0.9870
AT5G23120		HCF136	HIGH CHLOROPHYLL FLUORESCENCE ...		Potri.007G071300 [exp]	7.74	0.9856

Compare expression of checked genes

Potri.001G346100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.