PtrcGrx_C2 (Potri.001G347700) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol PtrcGrx_C2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G40370 157 / 3e-51 GRXC2 glutaredoxin C2, Glutaredoxin family protein (.1.2)
AT5G63030 138 / 2e-43 GRXC1 glutaredoxin C1, Thioredoxin superfamily protein (.1)
AT5G20500 91 / 7e-25 Glutaredoxin family protein (.1)
AT1G77370 88 / 9e-24 Glutaredoxin family protein (.1)
AT2G20270 85 / 5e-22 Thioredoxin superfamily protein (.1.2)
AT4G28730 80 / 6e-20 GrxC5 glutaredoxin C5, Glutaredoxin family protein (.1)
AT5G18600 71 / 2e-17 Thioredoxin superfamily protein (.1)
AT4G15680 71 / 5e-17 Thioredoxin superfamily protein (.1)
AT1G03020 70 / 7e-17 Thioredoxin superfamily protein (.1)
AT3G62930 69 / 2e-16 Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G078900 124 / 6e-38 AT5G63030 171 / 3e-56 glutaredoxin C1, Thioredoxin superfamily protein (.1)
Potri.012G082800 120 / 1e-36 AT5G63030 155 / 6e-50 glutaredoxin C1, Thioredoxin superfamily protein (.1)
Potri.018G133400 91 / 1e-24 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1)
Potri.007G017300 90 / 2e-24 AT1G77370 163 / 8e-53 Glutaredoxin family protein (.1)
Potri.002G254100 90 / 8e-24 AT4G28730 176 / 2e-56 glutaredoxin C5, Glutaredoxin family protein (.1)
Potri.008G214600 77 / 2e-19 AT5G18600 159 / 2e-52 Thioredoxin superfamily protein (.1)
Potri.008G214800 76 / 5e-19 AT5G18600 157 / 2e-51 Thioredoxin superfamily protein (.1)
Potri.001G060600 76 / 1e-18 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1)
Potri.014G134200 74 / 3e-18 AT3G62950 169 / 4e-56 Thioredoxin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022253 147 / 4e-47 AT5G40370 162 / 2e-53 glutaredoxin C2, Glutaredoxin family protein (.1.2)
Lus10013089 146 / 5e-47 AT5G40370 162 / 2e-53 glutaredoxin C2, Glutaredoxin family protein (.1.2)
Lus10042104 141 / 1e-44 AT5G63030 177 / 1e-58 glutaredoxin C1, Thioredoxin superfamily protein (.1)
Lus10001237 140 / 1e-44 AT5G63030 171 / 2e-56 glutaredoxin C1, Thioredoxin superfamily protein (.1)
Lus10017148 90 / 4e-24 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1)
Lus10021590 88 / 2e-23 AT5G20500 180 / 1e-59 Glutaredoxin family protein (.1)
Lus10028355 84 / 4e-22 AT1G77370 171 / 2e-56 Glutaredoxin family protein (.1)
Lus10022844 85 / 1e-21 AT4G28730 177 / 3e-57 glutaredoxin C5, Glutaredoxin family protein (.1)
Lus10005938 75 / 1e-18 AT3G62950 166 / 3e-55 Thioredoxin superfamily protein (.1)
Lus10040898 74 / 2e-18 AT3G62950 167 / 2e-55 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00462 Glutaredoxin Glutaredoxin
Representative CDS sequence
>Potri.001G347700.2 pacid=42791519 polypeptide=Potri.001G347700.2.p locus=Potri.001G347700 ID=Potri.001G347700.2.v4.1 annot-version=v4.1
ATGGCAATGAACAAGGCGAAGGAGCTGGTATCCACCAATCCCGTGGTGGTTTTCAGCAAGACATCCTGTCCATTTTGCGTCAAAGTGAAGCAGCTTCTGA
ATCAATTAGGAGCCAAATACACTACTGTGGAATTGGATACCGAGAAGGATGGAGGTGAAATACAATCAGCGTTGCATGAGTGGACTGGACAACGCACCGT
GCCAAATGTTTTCATTGGTGGCAACCACATCGGCGGCTGTGACAAAACCACAGGCATGCACCAGGAAGGAAAGCTGGTTCCTCTGCTTGCTGATGCTGGA
GCTGTTGCCTCTGCTTCTGCTTCTGCTTAA
AA sequence
>Potri.001G347700.2 pacid=42791519 polypeptide=Potri.001G347700.2.p locus=Potri.001G347700 ID=Potri.001G347700.2.v4.1 annot-version=v4.1
MAMNKAKELVSTNPVVVFSKTSCPFCVKVKQLLNQLGAKYTTVELDTEKDGGEIQSALHEWTGQRTVPNVFIGGNHIGGCDKTTGMHQEGKLVPLLADAG
AVASASASA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G40370 GRXC2 glutaredoxin C2, Glutaredoxin ... Potri.001G347700 0 1 PtrcGrx_C2
AT4G16520 ATG8F autophagy 8f, Ubiquitin-like s... Potri.014G060300 1.00 0.8395
AT2G24860 DnaJ/Hsp40 cysteine-rich domai... Potri.006G266800 1.41 0.8377
AT2G14860 Peroxisomal membrane 22 kDa (M... Potri.001G296400 3.87 0.8018
AT4G24440 transcription initiation facto... Potri.005G151700 6.24 0.7396
AT3G07170 Sterile alpha motif (SAM) doma... Potri.002G244700 10.48 0.7469
AT4G27040 VPS22 EAP30/Vps36 family protein (.1... Potri.001G424600 11.13 0.7039
AT5G07050 nodulin MtN21 /EamA-like trans... Potri.016G031400 12.16 0.6982
AT5G42300 UBL5 ubiquitin-like protein 5 (.1) Potri.008G039100 13.49 0.7707
AT2G46580 Pyridoxamine 5'-phosphate oxid... Potri.002G173800 15.29 0.7738
AT2G36930 C2H2ZnF zinc finger (C2H2 type) family... Potri.006G124100 16.49 0.7261

Potri.001G347700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.